PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G028100.2.p
Common NameLOC101781038, SETIT_021121mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 937aa    MW: 103074 Da    PI: 6.149
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G028100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.15.9e-22143243199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++i  ++++r++lt+GW+ Fv a++Lk+gD+v+F   
  Seita.3G028100.2.p 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNLWTFRHI-YRQPKRHLLTTGWSLFVGAKRLKAGDSVLFI-- 229
                         89*********************999*****9555555.49***************7.5667799************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         ++++ +l+v+v+r+
  Seita.3G028100.2.p 230 RDEKSQLLVGVRRA 243
                         4577778*****97 PP

2Auxin_resp109.53.5e-36268350183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaas++  F+++YnPr+s+s Fv+++++++ka++++ svGmRf  +fete+ss+rr++Gtvvg+sd+dp+rWpnSkWr+L+
  Seita.3G028100.2.p 268 AAHAASSGGSFTIYYNPRTSPSPFVIPLARYNKATYMQPSVGMRFATMFETEESSKRRCTGTVVGISDYDPMRWPNSKWRNLQ 350
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-42133271IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-38136256IPR015300DNA-binding pseudobarrel domain
CDDcd100171.57E-19142242No hitNo description
SMARTSM010191.4E-20143244IPR003340B3 DNA binding domain
PfamPF023621.7E-19143243IPR003340B3 DNA binding domain
PROSITE profilePS5086312.76143244IPR003340B3 DNA binding domain
PfamPF065071.8E-31268350IPR010525Auxin response factor
PROSITE profilePS5174523.737832916IPR000270PB1 domain
PfamPF023091.0E-8836919IPR033389AUX/IAA domain
SuperFamilySSF542775.1E-8851911No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 937 aa     Download sequence    Send to blast
MASSQEKATS GVLRNAAALL DEMQLMGETQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTKKVPNSR IPNYPSLPSQ LLCQVHNITL HADKETDEIY AQMTLQPVHS  120
ETEVFPIPSL GAYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NLWTFRHIYR QPKRHLLTTG WSLFVGAKRL KAGDSVLFIR DEKSQLLVGV  240
RRATRQQPAL SSSVLSTDSM HIGVLAAAAH AASSGGSFTI YYNPRTSPSP FVIPLARYNK  300
ATYMQPSVGM RFATMFETEE SSKRRCTGTV VGISDYDPMR WPNSKWRNLQ VEWDEHGYGE  360
RPERVSLWDI ETPENSLVFS SPLNSKRQCL PSYGVPGLQI GSVNMSSIPR AQGNPFGNLQ  420
HMPGIGSELA LMLLNQSGQN LGSPLACQQS SFSSIIQNVN HGYIPPSTFG ASTGSIKQES  480
MLSNEAQQQL SAPNIQKDDQ QGIDSTSAQE LDVRARGPRN TDSYSSQSIS DQNSKGEHRT  540
KTRRSKKGLS HKSISDKSEL SSVPSQICDD QRHGSEPKLV DCETEQVNCG NNEDSSGALT  600
RGGFAGEPQV QQVEQHELLA PPKFEPSKSP DGGKSVSSFP NQGCSPQFFE GLDWVIQPSY  660
YQDSNGIHSV SASENIFNQS ADITSTINAD TMEAFQNSCL SECFPNSVQE FISSPDLNSL  720
TFMSPDMQHL DGQHDVNNLP STSNSYVQMS YSEESGNQSA SLSGLHMEAI HINSSCSEPM  780
TTGSFDAGMF SKLPNLRDSQ VLPLQEIHNS SMGTPSCSMD AASVKPIKPP VRTYTKVQKL  840
GSVGRSIDVT RFRDYHELRS AIACMFGLQG KLEHPGSSDW KLVYVDYEND VLLVGDDPWE  900
EFINCVRCIR ILSPSEVQQM SENGVHVLND CIQIAQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.01737331390Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G028100.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660379.10.0auxin response factor 11 isoform X2
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLA0A368QB510.0A0A368QB51_SETIT; Auxin response factor
STRINGSi021121m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein
Publications ? help Back to Top
  1. Shen C, et al.
    Functional analysis of the structural domain of ARF proteins in rice (Oryza sativa L.).
    J. Exp. Bot., 2010. 61(14): p. 3971-81
    [PMID:20693412]
  2. Indoliya Y, et al.
    Decoding regulatory landscape of somatic embryogenesis reveals differential regulatory networks between japonica and indica rice subspecies.
    Sci Rep, 2016. 6: p. 23050
    [PMID:26973288]