PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.2G266600.2.p | ||||||||
Common Name | LOC101771024, SETIT_030960mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 242aa MW: 27707.5 Da PI: 9.4406 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.6 | 5.1e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gkl+e++s Seita.2G266600.2.p 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 99.4 | 5e-33 | 85 | 176 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +e++ +s+++e+ kLk+++enLqr+qR+llGedL+sL +k+L+qLe+qL++sl++iRs++++++l+q+ +lq++e++l e+nk+Lr+kle Seita.2G266600.2.p 85 KENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGSLGIKDLEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLE 175 46667899*********************************************************************************98 PP K-box 100 e 100 e Seita.2G266600.2.p 176 E 176 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.744 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.34E-43 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-32 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-26 | 87 | 174 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.382 | 90 | 180 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLFEFCSG 60 QSITKTLERY QKSSYGGPDT AVQNKENELV QSSRNEYLKL KARVENLQRT QRNLLGEDLG 120 SLGIKDLEQL EKQLDSSLRH IRSTRTQHML DQLTDLQRRE QMLCEANKCL RRKLEETSSQ 180 VNGQVWEHSA NLLGYERQSP QQAPSHVGNG FFHPLEVGPE PTLQIGFAPE HMNNFMPTWL 240 P* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 2e-32 | 75 | 176 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_B | 2e-32 | 75 | 176 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_C | 2e-32 | 75 | 176 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_D | 2e-32 | 75 | 176 | 1 | 103 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.2G266600.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ430694 | 0.0 | AJ430694.1 Zea mays mRNA for putative MADS-domain transcription factor (m27 gene). | |||
GenBank | BT087942 | 0.0 | BT087942.1 Zea mays full-length cDNA clone ZM_BFb0323H23 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004957289.1 | 1e-180 | MADS-box transcription factor 8 isoform X2 | ||||
Swissprot | Q9SAR1 | 1e-158 | MADS8_ORYSJ; MADS-box transcription factor 8 | ||||
TrEMBL | K3ZWI1 | 1e-178 | K3ZWI1_SETIT; Uncharacterized protein | ||||
STRING | Si030960m | 1e-177 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G24260.1 | 1e-92 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.2G266600.2.p |
Entrez Gene | 101771024 |
Publications ? help Back to Top | |||
---|---|---|---|
|