PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676773134 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 174aa MW: 19874.1 Da PI: 6.358 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.5 | 2e-15 | 91 | 134 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+ E++ ++++ ++G+g+W++I+r m+ Rt+ q+ s+ qky 676773134 91 PWTENEHKSFLEGLDKYGKGDWRSISRFMQ-SRTPTQVASHAQKY 134 8*****************************.*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.6 | 2 | 53 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.87E-5 | 4 | 58 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.583 | 84 | 139 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.64E-16 | 86 | 138 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 9.1E-17 | 87 | 138 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 8.1E-11 | 88 | 137 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-11 | 88 | 134 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.2E-13 | 91 | 134 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.69E-11 | 91 | 135 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MATKYWTRAD DKRFETALAQ FPDNSPTRFE DIASNLQIPF VDVIYYYDAL LHDIDLIESG 60 QYDTITYPED DVAGISSQTK HMGTNMKKGT PWTENEHKSF LEGLDKYGKG DWRSISRFMQ 120 SRTPTQVASH AQKYFLRQSV DKAKKRSSIH DIASVDNAAN NGTVPPDDFL GIRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00344 | DAP | Transfer from AT3G10580 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676773134 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013730893.1 | 6e-69 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 7e-38 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 7e-38 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | M4EZ87 | 3e-66 | M4EZ87_BRARP; Uncharacterized protein | ||||
STRING | Bra034130.1-P | 4e-67 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5127 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09450.1 | 3e-54 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|