PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676709648 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 162aa MW: 19030.2 Da PI: 9.2002 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.6 | 2.4e-12 | 71 | 124 | 5 | 58 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 +++r+k++NRe+ArrsR RK+ ++eeL v L +eN++L +l++ + +k 676709648 71 RKQRKKISNRESARRSRMRKQRQLEELWSQVIRLRNENHQLLRKLNRVLESNEK 124 689******************************************998777665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-9 | 66 | 125 | No hit | No description |
SMART | SM00338 | 3.9E-13 | 67 | 131 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.795 | 69 | 132 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.0E-9 | 71 | 124 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.34E-10 | 71 | 121 | No hit | No description |
CDD | cd14702 | 1.43E-16 | 72 | 120 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 74 | 89 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MQPSTNIFSL HGCPPSYLSQ FPTTSPFRVS GQNHNPYYSF PTSVNPSQFM NSNNSTSDEA 60 EENQRDVMNE RKQRKKISNR ESARRSRMRK QRQLEELWSQ VIRLRNENHQ LLRKLNRVLE 120 SNEKVIEENG QLKDETSELK QMISDMQLQN QTPLSCLRDD TV |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 83 | 90 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00533 | DAP | Transfer from AT5G38800 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676709648 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006405699.2 | 4e-90 | LOW QUALITY PROTEIN: basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 1e-87 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | V4LX90 | 6e-90 | V4LX90_EUTSA; Uncharacterized protein | ||||
STRING | XP_006405699.1 | 1e-90 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G38800.1 | 6e-90 | basic leucine-zipper 43 |
Publications ? help Back to Top | |||
---|---|---|---|
|