PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676704342 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 124aa MW: 14002 Da PI: 6.1295 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 97.2 | 1.3e-30 | 13 | 76 | 8 | 71 |
NF-YC 8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkr 71 q+e ++dfk h+l larikki+k+ dv+misaeaP++++kace+f ++lt rswlhaee k 676704342 13 PQMEAVKDFKSHQLTLARIKKIMKSKHDVRMISAEAPIVFAKACEMFPVDLTTRSWLHAEEDKH 76 48**********************************************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 6.11E-19 | 2 | 79 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 3.8E-25 | 17 | 85 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-11 | 26 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MDHNDNICNH QPPQMEAVKD FKSHQLTLAR IKKIMKSKHD VRMISAEAPI VFAKACEMFP 60 VDLTTRSWLH AEEDKHCYVA VPHLDGGVQY YYPPVIDGSG MYALQQQVWP SCWPVASCGG 120 DGED |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 6e-25 | 11 | 76 | 3 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676704342 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006402087.1 | 1e-43 | nuclear transcription factor Y subunit C-6 | ||||
Swissprot | Q9FGP7 | 5e-34 | NFYC6_ARATH; Nuclear transcription factor Y subunit C-6 | ||||
TrEMBL | V4KZY0 | 3e-42 | V4KZY0_EUTSA; Uncharacterized protein | ||||
STRING | XP_006402087.1 | 6e-43 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM478 | 28 | 160 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50480.1 | 2e-36 | nuclear factor Y, subunit C6 |
Publications ? help Back to Top | |||
---|---|---|---|
|