PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011092697.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 187aa MW: 21680.3 Da PI: 4.6201 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 121.8 | 6.3e-38 | 8 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF Ptdeelvv++L++k+ +++ +vi+++d+y ++PwdL+ k+ ae ++wyf+s+r + +r+t+sgyW++ g +++++s+ XP_011092697.1 8 LPPGFRFFPTDEELVVHFLHRKALLLPCHP-DVIPDLDLYPYDPWDLDGKAMAEGRKWYFYSRRTQ--------SRVTESGYWQSIGVEEPIFSS 93 79*************************999.99**************977778899******9854........79******************* PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+ +g+kk +fy g+ ++g+kt+W+m+eyrl XP_011092697.1 94 SGQRIGMKKYCAFYIGEPSEGVKTNWIMQEYRL 126 *******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.48E-48 | 5 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.875 | 8 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-22 | 9 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MGDSSFNLPP GFRFFPTDEE LVVHFLHRKA LLLPCHPDVI PDLDLYPYDP WDLDGKAMAE 60 GRKWYFYSRR TQSRVTESGY WQSIGVEEPI FSSSGQRIGM KKYCAFYIGE PSEGVKTNWI 120 MQEYRLMDSS STSRSSKRRN SKIDYSKWVV CLVYEKGDND HDEGTELSCL DEVFLSMDDL 180 DEISLPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-42 | 4 | 156 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-42 | 4 | 156 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-42 | 4 | 156 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-42 | 4 | 156 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swm_B | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swm_C | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swm_D | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swp_A | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swp_B | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swp_C | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
3swp_D | 2e-42 | 4 | 156 | 16 | 168 | NAC domain-containing protein 19 |
4dul_A | 1e-42 | 4 | 156 | 13 | 165 | NAC domain-containing protein 19 |
4dul_B | 1e-42 | 4 | 156 | 13 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011092697.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011092697.1 | 1e-138 | NAC domain-containing protein 104 isoform X1 | ||||
Refseq | XP_020553092.1 | 1e-138 | NAC domain-containing protein 104 isoform X1 | ||||
Refseq | XP_020553093.1 | 1e-138 | NAC domain-containing protein 104 isoform X1 | ||||
Swissprot | Q8GWK6 | 3e-82 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A2G9GLR7 | 2e-98 | A0A2G9GLR7_9LAMI; Uncharacterized protein | ||||
STRING | XP_009762857.1 | 1e-96 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 6e-72 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|