Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 87.5 | 7.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvtfskRr g+lKKA+EL vLCdaeva+iifsstgkl+e++s
Sphfalx0119s0043.1.p 9 KKIENPTSRQVTFSKRRGGLLKKAHELAVLCDAEVALIIFSSTGKLFEFAS 59
68***********************************************86 PP
|
2 | K-box | 84.5 | 2.2e-28 | 83 | 172 | 10 | 99 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
+++ + + +e+ kL++++e Lq++qRh+lGedL++L++ +L qLeqqL+ + +++ ++Kn+lll++ie+l++ke++lq+en +L +kl
Sphfalx0119s0043.1.p 83 NNNSSDLMGHEVLKLRQQLERLQTTQRHMLGEDLSQLTVPDLLQLEQQLDMGSSRVQERKNQLLLKEIEDLRRKEHDLQQENAELLHKL 171
445567799******************************************************************************98 PP
K-box 99 e 99
+
Sphfalx0119s0043.1.p 172 A 172
6 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
SMART | SM00432 | 1.6E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.011 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.02E-47 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 8.5E-34 | 2 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.1E-26 | 82 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.998 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009553 | Biological Process | embryo sac development |
GO:0009911 | Biological Process | positive regulation of flower development |
GO:0010094 | Biological Process | specification of carpel identity |
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:0048455 | Biological Process | stamen formation |
GO:0048459 | Biological Process | floral whorl structural organization |
GO:0048509 | Biological Process | regulation of meristem development |
GO:0048833 | Biological Process | specification of floral organ number |
GO:0080060 | Biological Process | integument development |
GO:0080112 | Biological Process | seed growth |
GO:0005634 | Cellular Component | nucleus |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0046983 | Molecular Function | protein dimerization activity |