PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G45650.1

Common Name

AGL6, F17K2.18, RSB1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 252aa MW: 28744.5 Da PI: 7.853

Description

AGAMOUS-like 6

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G45650.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.1	8.5e-32	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ AT2G45650.1 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP
2	K-box	99.9	3.6e-33	76	171	4	99
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 s ++++ e++++s++qe++kLk+++e+L r++R+llGedL+++ +keLq Le+qLe +l+ R++K+++++e++e+l+kke++l ++nk+L+ k+e AT2G45650.1 76 SLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFE 171 4455678999**********************************************************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.431	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	7.4E-42	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.29E-45	2	72	No hit	No description
SuperFamily	SSF55455	6.02E-34	2	89	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	8.4E-30	83	170	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.279	86	176	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009553	Biological Process	embryo sac development
GO:0009911	Biological Process	positive regulation of flower development
GO:0010094	Biological Process	specification of carpel identity
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010582	Biological Process	floral meristem determinacy
GO:0030154	Biological Process	cell differentiation
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048437	Biological Process	floral organ development
GO:0048455	Biological Process	stamen formation
GO:0048459	Biological Process	floral whorl structural organization
GO:0048509	Biological Process	regulation of meristem development
GO:0048833	Biological Process	specification of floral organ number
GO:0080060	Biological Process	integument development
GO:0080112	Biological Process	seed growth
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0020003	anatomy	plant ovule
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 252 aa Download sequence Send to blast
MGRGRVEMKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSV 60 GIESTIERYN RCYNCSLSNN KPEETTQSWC QEVTKLKSKY ESLVRTNRNL LGEDLGEMGV 120 KELQALERQL EAALTATRQR KTQVMMEEME DLRKKERQLG DINKQLKIKF ETEGHAFKTF 180 QDLWANSAAS VAGDPNNSEF PVEPSHPNVL DCNTEPFLQI GFQQHYYVQG EGSSVSKSNV 240 AGETNFVQGW VL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	1	69	1	69	MEF2C
5f28_B	1e-20	1	69	1	69	MEF2C
5f28_C	1e-20	1	69	1	69	MEF2C
5f28_D	1e-20	1	69	1	69	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.512	0.0	flower

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	1019924	0.0
Genevisible	267528_at	0.0
Expression Atlas	AT2G45650	-
AtGenExpress	AT2G45650	-
ATTED-II	AT2G45650	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in flowers.

Functional Description ? help Back to Top
Source	Description
TAIR	sequence suggests this encodes a MADS-box transcription factor
UniProt	Probable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.

Function -- GeneRIF ? help Back to Top
AGL6 and AGL13 are regulated through complex interactions of enhancer and silencer elements located in both the 5'-upstream regions and the large first introns. [PMID: 19473325] Early flowering and developmental defects are caused by overexpression of AGL6. [PMID: 20230491] Results suggest that AGL6 acts as a floral promoter with a dual role, the inhibition of the transcription of the FLC/MAF genes and the promotion of FT expression in Arabidopsis. [PMID: 21175890] agamous-like 6 plays a potential role in the regulation of the circadian clock by regulating zeitlupe mRNA level in Arabidopsis [PMID: 21331777] a function of AGAMOUS-LIKE6 in axillary bud formation in Arabidopsis [PMID: 22730404]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00315	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G45650.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction -- BIND ? help Back to Top
Source	Intact With	Description
BIND	AT4G18960	AG interacts with AGL6.

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G45660, AT3G57230, AT4G18960, AT4G24540, AT4G37940, AT5G13790, AT5G15800, AT5G27070, AT5G27130, AT5G60910, AT5G62165, AT5G65330, AT1G24260, AT1G31630, AT1G31640, AT1G46408, AT1G48150, AT1G69120, AT1G77980
IntAct	Search P29386

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G45650

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	ATHAGL6A	0.0	M55554.1 Arabidopsis thaliana transcription factor (AGL6) mRNA, complete cds.
GenBank	DQ446624	0.0	DQ446624.1 Arabidopsis thaliana clone pENTR221-At2g45650 MADS-box protein (At2g45650) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182089.1	0.0	AGAMOUS-like 6
Swissprot	P29386	0.0	AGL6_ARATH; Agamous-like MADS-box protein AGL6
TrEMBL	Q1PEU3	0.0	Q1PEU3_ARATH; AGAMOUS-like protein 6
STRING	AT2G45650.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4302	26	54
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G45650.1
Entrez Gene	819173
iHOP	AT2G45650
wikigenes	AT2G45650

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ma H,Yanofsky MF,Meyerowitz EM AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes. Genes Dev., 1991. 5(3): p. 484-95 [PMID:1672119] Fan J,Li W,Dong X,Guo W,Shu H Ectopic expression of a hyacinth AGL6 homolog caused earlier flowering and homeotic conversion in Arabidopsis. Sci. China, C, Life Sci., 2007. 50(5): p. 676-89 [PMID:17879068] Schauer SE, et al. Intronic regulatory elements determine the divergent expression patterns of AGAMOUS-LIKE6 subfamily members in Arabidopsis. Plant J., 2009. 59(6): p. 987-1000 [PMID:19473325] Koo SC, et al. Control of lateral organ development and flowering time by the Arabidopsis thaliana MADS-box Gene AGAMOUS-LIKE6. Plant J., 2010. 62(5): p. 807-16 [PMID:20230491] Yoo SK,Wu X,Lee JS,Ahn JH AGAMOUS-LIKE 6 is a floral promoter that negatively regulates the FLC/MAF clade genes and positively regulates FT in Arabidopsis. Plant J., 2011. 65(1): p. 62-76 [PMID:21175890] Yoo SK,Hong SM,Lee JS,Ahn JH A genetic screen for leaf movement mutants identifies a potential role for AGAMOUS-LIKE 6 (AGL6) in circadian-clock control. Mol. Cells, 2011. 31(3): p. 281-7 [PMID:21331777] Huang X,Effgen S,Meyer RC,Theres K,Koornneef M Epistatic natural allelic variation reveals a function of AGAMOUS-LIKE6 in axillary bud formation in Arabidopsis. Plant Cell, 2012. 24(6): p. 2364-79 [PMID:22730404] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504] Tandre K,Albert VA,Sund Conifer homologues to genes that control floral development in angiosperms. Plant Mol. Biol., 1995. 27(1): p. 69-78 [PMID:7865797] Fan HY,Hu Y,Tudor M,Ma H Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins. Plant J., 1997. 12(5): p. 999-1010 [PMID:9418042] Mouradov A, et al. Family of MADS-Box genes expressed early in male and female reproductive structures of monterey pine Plant Physiol., 1998. 117(1): p. 55-62 [PMID:9576774]