PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0021s0179.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 508aa    MW: 54982.2 Da    PI: 9.8031
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0021s0179.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.6e-3351105155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+rlrW+peLHerFv+av+qLGG+e+AtPk +l++m+v+gLt++hvkSHLQkYRl
  Sphfalx0021s0179.1.p  51 KQRLRWSPELHERFVDAVSQLGGPERATPKGVLRVMGVQGLTIYHVKSHLQKYRL 105
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.22948108IPR017930Myb domain
SuperFamilySSF466897.88E-1750105IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-3150106IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-2551106IPR006447Myb domain, plants
PfamPF002492.2E-953104IPR001005SANT/Myb domain
PfamPF143792.2E-21148190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MYHQTKKFAI VTHHGTARSA STCNDNIVSP GLESPGGSSP SAAAGGGGGA KQRLRWSPEL  60
HERFVDAVSQ LGGPERATPK GVLRVMGVQG LTIYHVKSHL QKYRLAKYVP ESASDGSKLE  120
KKNIPGASDS VVPASDATSS GVQVVDSDAL HMQMEVQKRL HEQLEVQRHL QLRMEAQSKY  180
LKRIIEEQQQ RAAGTQDVAG RHPVVTAASG HEQEERRVSL VKEPSSEAES VDVNERKLTR  240
LPDLRLSIVE QEVAMPSSWA SDKQRATRSS PCNITREHQF AITASGAASS QASALLRPTQ  300
LQQAAQVQYS SASGYSHAAS AFTSSWTLSQ PSSKRTRFGS ELMSSFSQSL SPELDLRQHG  360
RGMGSSSNEF QQSIQVQRTP IIPLNPASNR YGFNLAMGFQ RSSYIHESAQ VLYAPQPLLS  420
SPGDSLHLQS HGFQRPAATQ GAAHQHVFMQ PERGMSSFQV AKGEEEGSPL LPAPKSRASD  480
ALRQMFRRWE ENSGGNAGGT SSQGNTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-2551108158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2551108158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2551108158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2551108158Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-62G2-like family protein