PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0003s0329.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 480aa    MW: 52171.2 Da    PI: 4.6422
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0003s0329.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.55.5e-27183237156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k++++Wt+eLH++Fv+aveqL G ekA+P++ilelm+v++Lt+++++SHLQkYR++
  Sphfalx0003s0329.1.p 183 KTKVDWTQELHRHFVQAVEQL-GVEKAIPSRILELMGVQCLTRHNIASHLQKYRSH 237
                           6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.148180239IPR017930Myb domain
SuperFamilySSF466895.64E-18181240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-25181240IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-25183237IPR006447Myb domain, plants
PfamPF002494.1E-6186235IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MPTWAGMTHV KVEEEDVDEK KVEILDSLIS MNLTQCIDSS SMKEEEDFNF QFLEQSGTKL  60
ECDNSLEGFH FGNGGGVGEF NEDTREQLDA DMDAACTRVL DLPTTSSSMC LDFESLDSVD  120
GQETNGPDES IEIGEEEALL LAAAATAADE SSDRESIGPV EQTSSSQCRN KGSKGAASSG  180
RRKTKVDWTQ ELHRHFVQAV EQLGVEKAIP SRILELMGVQ CLTRHNIASH LQKYRSHRRH  240
MIARDVEAAS WRHRRPLTWA RSQQEGNAWL APIQTSSSFP AAHPYASAGL PTIQPRLPAH  300
GHHIGAHLVV WGHPTVDHSP SHMWQQPPVN TLPFSQEPDS STYWQQTAPA CIDSWTHPSI  360
FPAFPYPFFG APYAPSFCAS QLVAPGITSN ERSLMDESLP VALYQTTAID SDISAAAGAA  420
ACSKPSDFLP PQEILDAVIS EALANPCTPL PLGLKPPSVA AVMAELFRQG INIVATSTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16179235157ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A176WS141e-119A0A176WS14_MARPO; Uncharacterized protein
TrEMBLA0A2R6W4C31e-119A0A2R6W4C3_MARPO; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-43GBF's pro-rich region-interacting factor 1