PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0001s0234.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family G2-like
Protein Properties Length: 682aa    MW: 73514.3 Da    PI: 5.8744
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0001s0234.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61.1e-31354408155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k rlrWtpeLHe+Fv av+ LGG+++AtPk++l++m+v+g+t++hvkSHLQkYRl
  Sphfalx0001s0234.1.p 354 KSRLRWTPELHEKFVAAVSDLGGADRATPKAVLRIMGVQGITIYHVKSHLQKYRL 408
                           68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.56351411IPR017930Myb domain
SuperFamilySSF466892.69E-16353408IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23354409IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.0E-30354409IPR009057Homeodomain-like
PfamPF002494.6E-8356407IPR001005SANT/Myb domain
PfamPF143793.7E-21440483IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MLMNRQGMEG WQQPSQVSNS HAAAAASPDP AAPVVVTMPT PQLNPHRAFA RPNPPGKTQG  60
GRGPAWAAME GSSSSSSSSA AFTQPRHGYY QPPPPLPPQM ENQRQVGMHG DSGMSSQYQY  120
PQSQGPYPAQ PGPGTEPSSP HYGQQQQMSA HHSYQSPAHW SPGAQWPNHH QQQQQHPVPL  180
PPALQQSGGH WQAGNKQLLP SPTGLAGQSD TTAALHSCAL DQANGPKTQD NRDGTDFRDQ  240
LQVLLDSPDG DGDSSQMGEQ SVNDGFGAGP EWLKWTELVP QEETIANCWT EIIDVESGEE  300
RTLFQTTRFE PLAPTTLQPR SLPTDQQPSG SAGGQYPESP GPSSAAAAAA AAVKSRLRWT  360
PELHEKFVAA VSDLGGADRA TPKAVLRIMG VQGITIYHVK SHLQKYRLAK YMPEISEETR  420
AERRRNDTYL QPMGISSSQQ ITQALQMQME VQKRLHEQLE VQRELQLRIE AQGKSLQKMI  480
EQQGGMVSRC WSEPHDPSSL ATVPATPVPE TPVRSSIVPV TDSPHQASAL ESDIPVTDRA  540
PLPASTVDQP DLKHERLISE PKEDQPPPAL ITSNEEPSLK KARMDVNPQA SSLVQVPVSV  600
TSDAQRGGGS DTQENVQQEV GLETSPEMVT QKLTSPALEA QEVTEGHQAH SFAQCTPQQG  660
HTACAPPHPG SIAHKPVHAS G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-23354411158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-23354411158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-23354411158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-23354411158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23354411259Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-54G2-like family protein