PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.009G050600.1.p | ||||||||
Common Name | Sb09g004315, SORBIDRAFT_09g004315 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 157aa MW: 17377.7 Da PI: 10.3527 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.5 | 4.4e-19 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt Tp+WR gp g+++LCnaCG++yrkk++ Sobic.009G050600.1.p 28 CVECRTTATPMWRGGPTGPRSLCNACGIRYRKKRR 62 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.4E-14 | 22 | 81 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.9E-13 | 25 | 63 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.0E-14 | 27 | 63 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.176 | 28 | 58 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 6.1E-17 | 28 | 62 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 7.87E-12 | 28 | 63 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MMMDSAAEHQ HHKVIGIAPV AEAGRPCCVE CRTTATPMWR GGPTGPRSLC NACGIRYRKK 60 RRQELGLDTT KKPQQNQAQP QTPQQQQQQQ QQQQQQQHQD QDQSHSQATS AVVKENNTKS 120 SNLQVVKKRR VLMGVEEAAI LLMALSSSSR STLLHG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.009G050600.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728012 | 4e-62 | KJ728012.1 Zea mays clone pUT6147 C2C2-GATA transcription factor (GATA12) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002440630.2 | 1e-111 | GATA transcription factor 23 | ||||
TrEMBL | A0A1B6P6L4 | 1e-110 | A0A1B6P6L4_SORBI; Uncharacterized protein | ||||
STRING | Sb09g004315.1 | 1e-111 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 2e-20 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.009G050600.1.p |
Entrez Gene | 8076012 |