![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.007G146500.1.p | ||||||||
Common Name | Sb07g022120, SORBIDRAFT_07g022120 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 226aa MW: 24239.2 Da PI: 5.4228 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.8 | 1.6e-15 | 16 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + +WT+ Ede l +av+++G +W++Ia + gR +k+c++rw ++l Sobic.007G146500.1.p 16 KTPWTEKEDEALRRAVREHGRQNWAAIAGAVA-GRGAKSCRLRWCQHL 62 579*****************************.***********9986 PP | |||||||
2 | Myb_DNA-binding | 47.5 | 4.2e-15 | 70 | 111 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++T+eEd ++v++ +G++ W+tIar + gR+++ +k+rw++ Sobic.007G146500.1.p 70 PFTPEEDARIVELQGVHGNK-WATIARFLH-GRSDNAVKNRWNS 111 89******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.34 | 11 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.64E-29 | 14 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-15 | 15 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.4E-15 | 16 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.1E-22 | 18 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.15E-14 | 18 | 62 | No hit | No description |
SMART | SM00717 | 8.3E-12 | 67 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 17.313 | 69 | 117 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.8E-12 | 70 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.7E-21 | 70 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.61E-10 | 70 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MAAAQCGEGK AADCKKTPWT EKEDEALRRA VREHGRQNWA AIAGAVAGRG AKSCRLRWCQ 60 HLAPELDSRP FTPEEDARIV ELQGVHGNKW ATIARFLHGR SDNAVKNRWN SALRKMHQQG 120 YYPAAVAAAA EDDAEDTDGQ AAEAVVCLDL FPLRARAMGE ATAADRLVVR EEEVEGEGDV 180 AVEPIGLGLK LGSPGLSDAE LELSLGPVRP SSSNRGEAAS FRLCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-27 | 13 | 115 | 4 | 106 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.007G146500.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012616 | 6e-90 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002444450.1 | 1e-163 | transcription factor MYB25 | ||||
Swissprot | Q9SN12 | 3e-41 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | C5YLR9 | 1e-161 | C5YLR9_SORBI; Uncharacterized protein | ||||
STRING | Sb07g022120.1 | 1e-162 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 1e-36 | myb domain protein 77 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.007G146500.1.p |
Entrez Gene | 8077877 |
Publications ? help Back to Top | |||
---|---|---|---|
|