PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.003G406800.2.p | ||||||||
Common Name | Sb03g044170, SORBIDRAFT_03g044170 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 142aa MW: 16029.9 Da PI: 8.4306 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.3 | 1.3e-25 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k rqv fskRr+g++KKA+EL LCdaeva+++fs+ gklyeyss Sobic.003G406800.2.p 11 RIEDKASRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPGGKLYEYSS 60 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.5E-33 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.763 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.00E-40 | 3 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.27E-30 | 4 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-27 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.1E-25 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-27 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-27 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MARRGRVELR RIEDKASRQV RFSKRRAGLF KKAFELALLC DAEVALLVFS PGGKLYEYSS 60 TSIEDTYDRY QQFAGAGRNV NGDNNDNPDV AASDLQSRLK EIATWSEQHN AEESDANELE 120 KLEKLLANAL RNTKTKRSPE Y* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
5f28_A | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
5f28_B | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
5f28_C | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
5f28_D | 2e-18 | 4 | 73 | 3 | 72 | MEF2C |
6byy_A | 2e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
6byy_B | 2e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
6byy_C | 2e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
6byy_D | 2e-18 | 4 | 74 | 3 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sbi.9608 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10382970}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.003G406800.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT038349 | 1e-177 | BT038349.1 Zea mays full-length cDNA clone ZM_BFb0228B20 mRNA, complete cds. | |||
GenBank | KJ726934 | 1e-177 | KJ726934.1 Zea mays clone pUT3480 MADS transcription factor (MADS69) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021311355.1 | 1e-100 | MADS-box transcription factor 51 isoform X2 | ||||
Swissprot | Q9XJ61 | 2e-69 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
TrEMBL | A0A1W0W168 | 1e-98 | A0A1W0W168_SORBI; Uncharacterized protein | ||||
STRING | Sb03g044170.1 | 7e-96 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45660.1 | 1e-29 | AGAMOUS-like 20 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.003G406800.2.p |
Entrez Gene | 8079807 |
Publications ? help Back to Top | |||
---|---|---|---|
|