PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.002G421800.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 261aa MW: 27606.8 Da PI: 9.6014 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 48.1 | 1.9e-15 | 17 | 77 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 r+R+t+++eq+ +Le+ F++ +p ++e ++ k l + +++V++WFqNrR + ++ Sobic.002G421800.2.p 17 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 77 89*****************99*************************************997 PP | |||||||
2 | Wus_type_Homeobox | 107.3 | 9e-35 | 16 | 79 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q Sobic.002G421800.2.p 16 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 79 589***********************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 11.24 | 13 | 78 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.03E-13 | 14 | 84 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.9E-6 | 15 | 82 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-8 | 17 | 84 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 3.6E-13 | 17 | 77 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009734 | Biological Process | auxin-activated signaling pathway | ||||
GO:0048830 | Biological Process | adventitious root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 261 aa Download sequence Send to blast |
MEGGLSPERH AAAEPVRSRW TPKPEQILIL ESIFNSGMVN PPKDETVRIR KLLERFGAVG 60 DANVFYWFQN RRSRSRRRQR QLQAQAAAAA AAGSSSSSGS PPTTGLAPGH AAASSTMGMF 120 AHGAAYGSSA STSWPPSPPP SSAAMMGDLD YGGGDDLFAI SRQMGYANGG GSGSASSAAV 180 AHHEQQLYYS PCQPGERAKS HAMHACFVLS IQGSIDAWFS STSLPSSGKL NPFTASPFGS 240 YPYWHARHNI IIFINTSQSI * |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In crown roots, mainly expressed after crown roots emergence but barely in crown root initials. {ECO:0000269|PubMed:26307379}. | |||||
Uniprot | TISSUE SPECIFICITY: Present in crown roots. {ECO:0000269|PubMed:26307379}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in crown root development (PubMed:26307379, PubMed:29740464). Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system (PubMed:26307379, PubMed:29740464). Regulates the expression of genes required for crown root development, and hormone-responsive genes involved in cytokinin signaling (e.g. RR1, RR2, RR3 and RR4), and auxin signaling (e.g. IAA5, IAA11, IAA23 and IAA31) (PubMed:26307379). Functions dowstream of the auxin biosynthetic genes YUCCA1 in the promotion of crown root development (PubMed:29740464). {ECO:0000269|PubMed:26307379, ECO:0000269|PubMed:29740464}. | |||||
UniProt | Transcription factor which may be involved in developmental processes. Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system, by regulating the expression of genes required for crown root development and hormone-responsive genes involved in cytokinin (e.g. RR1, RR2, RR3 and RR4) and auxin (e.g. IAA5, IAA11, IAA23 and IAA31) signaling. {ECO:0000250|UniProtKB:Q0D3I7}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00330 | DAP | Transfer from AT3G03660 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.002G421800.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK063503 | 1e-105 | AK063503.1 Oryza sativa Japonica Group cDNA clone:001-116-E11, full insert sequence. | |||
GenBank | AK073232 | 1e-105 | AK073232.1 Oryza sativa Japonica Group cDNA clone:J033021B15, full insert sequence. | |||
GenBank | AP005167 | 1e-105 | AP005167.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0060O17. | |||
GenBank | AP014963 | 1e-105 | AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012615 | 1e-105 | CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021308503.1 | 1e-138 | WUSCHEL-related homeobox 11 | ||||
Swissprot | B8B644 | 4e-54 | WOX11_ORYSI; WUSCHEL-related homeobox 11 | ||||
Swissprot | Q0D3I7 | 4e-54 | WOX11_ORYSJ; WUSCHEL-related homeobox 11 | ||||
TrEMBL | A0A1W0W820 | 0.0 | A0A1W0W820_SORBI; Uncharacterized protein | ||||
STRING | Sb02g043300.1 | 1e-137 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1078 | 37 | 109 | Representative plant | OGRP4697 | 12 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G03660.1 | 1e-34 | WUSCHEL related homeobox 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.002G421800.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|