PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_74785.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 102aa MW: 11203.7 Da PI: 7.2581 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 82.1 | 1.5e-25 | 1 | 65 | 9 | 73 |
TCP 9 skihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 sk++T +g+RdRR+Rlsa++a++++dLqd+LG+ ++sk i+WLlq+a+ + l+ +++++ + Rsa1.0_74785.1_g00001.1 1 SKVCTVRGLRDRRIRLSATTAIQLYDLQDRLGLSQPSKVIDWLLQAAQNDVAMLPPLQFPPGFHL 65 8*******************************************************988877444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 3.3E-23 | 1 | 58 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 24.446 | 1 | 54 | IPR017887 | Transcription factor TCP subgroup |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
SKVCTVRGLR DRRIRLSATT AIQLYDLQDR LGLSQPSKVI DWLLQAAQND VAMLPPLQFP 60 PGFHLNLPTA AAAVGESFPG IFESFDIGSC SSRTDQTTQR ET |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 3e-18 | 1 | 55 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 3e-18 | 1 | 55 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_74785.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC241004 | 1e-110 | AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018475137.1 | 7e-65 | PREDICTED: transcription factor TCP17 | ||||
Refseq | XP_018475138.1 | 7e-65 | PREDICTED: transcription factor TCP17 | ||||
Swissprot | Q9LEZ9 | 9e-40 | TCP17_ARATH; Transcription factor TCP17 | ||||
TrEMBL | A0A3P6A0R2 | 4e-59 | A0A3P6A0R2_BRACM; Uncharacterized protein | ||||
STRING | Bo3g004670.1 | 8e-57 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3576 | 27 | 63 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08070.1 | 4e-42 | TCP domain protein 17 |
Publications ? help Back to Top | |||
---|---|---|---|
|