PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G08070.1 | ||||||||
Common Name | T22D6.10, TCP17 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 242aa MW: 27411.8 Da PI: 9.3594 | ||||||||
Description | TCP domain protein 17 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 92.3 | 1e-28 | 31 | 99 | 2 | 70 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 g+kdrhsk++T +g+RdRR+Rls+ +a++++dLq++LG+ ++sk i+WLl+ ak ++ l+ +++++ AT5G08070.1 31 FGGKDRHSKVCTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPG 99 689***********************************************************9977776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 28.31 | 33 | 91 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 6.6E-27 | 33 | 132 | IPR005333 | Transcription factor, TCP |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045962 | Biological Process | positive regulation of development, heterochronic | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000056 | anatomy | flower bud | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MGIKKEDQKS SLSLLTQRWN NPRIVRVSRA FGGKDRHSKV CTVRGLRDRR IRLSVMTAIQ 60 VYDLQERLGL SQPSKVIDWL LEVAKNDVDL LPPLQFPPGF HQLNPNLTGL GESFPGVFDL 120 GRTQREALDL EKRKWVNLDH VFDHIDHHNH FSNSIQSNKL YFPTITSSSS SYHYNLGHLQ 180 QSLLDQSGNV TVAFSNNYNN NNLNPPAAET MSSLFPTRYP SFLGGGQLQL FSSTSSQPDH 240 IE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 3e-17 | 38 | 92 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 3e-17 | 38 | 92 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 250566_at | 0.0 | ||||
Expression Atlas | AT5G08070 | - | ||||
AtGenExpress | AT5G08070 | - | ||||
ATTED-II | AT5G08070 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, roots, stems, buds, flowers and siliques. {ECO:0000269|PubMed:17307931}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | TCP gene involved in heterochronic control of leaf differentiation. | |||||
UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00497 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G08070.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G08330, AT5G51910, AT5G60970, AT1G30210, AT1G35560, AT1G53230, AT1G58100, AT1G69690 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G08070 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL357612 | 0.0 | AL357612.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T22D6 (ESSA project). | |||
GenBank | BT029995 | 0.0 | BT029995.1 Arabidopsis thaliana At5g08070 mRNA, complete cds. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001318505.1 | 1e-179 | TCP domain protein 17 | ||||
Refseq | NP_196424.1 | 1e-179 | TCP domain protein 17 | ||||
Swissprot | Q9LEZ9 | 1e-180 | TCP17_ARATH; Transcription factor TCP17 | ||||
TrEMBL | A0A178UHH9 | 1e-178 | A0A178UHH9_ARATH; TCP17 | ||||
STRING | AT5G08070.1 | 1e-179 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3576 | 27 | 63 | Representative plant | OGRP180 | 15 | 163 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G08070.1 |
Entrez Gene | 830701 |
iHOP | AT5G08070 |
wikigenes | AT5G08070 |