PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_60976.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 57aa MW: 6638.57 Da PI: 4.2669 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 62.8 | 1.1e-19 | 12 | 57 | 2 | 48 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 ppGfrFhPtdeelv +yLkkkv++++++l +vi+e+d+yk+ePwdL+ Rsa1.0_60976.1_g00001.1 12 PPGFRFHPTDEELVGYYLKKKVASQSIDL-DVIREIDLYKIEPWDLQ 57 9****************************.9**************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-19 | 7 | 56 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 21.883 | 11 | 57 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.5E-10 | 12 | 54 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
MMGPVDQESS IPPGFRFHPT DEELVGYYLK KKVASQSIDL DVIREIDLYK IEPWDLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 7e-16 | 6 | 56 | 10 | 60 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_60976.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738278 | 7e-80 | KF738278.1 Brassica napus NAC transcription factor 105 (NAC105.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013596223.1 | 2e-33 | PREDICTED: NAC domain-containing protein 105 isoform X1 | ||||
Refseq | XP_013596224.1 | 2e-33 | PREDICTED: NAC domain-containing protein 105 isoform X2 | ||||
Refseq | XP_013651709.1 | 2e-33 | NAC domain-containing protein 105-like isoform X1 | ||||
Refseq | XP_018463816.1 | 2e-33 | PREDICTED: NAC domain-containing protein 105-like | ||||
Swissprot | O65508 | 8e-28 | NAC76_ARATH; NAC domain-containing protein 76 | ||||
TrEMBL | A0A078H1T9 | 4e-32 | A0A078H1T9_BRANA; BnaC07g16780D protein | ||||
TrEMBL | A0A0D3D8I4 | 4e-32 | A0A0D3D8I4_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6ER49 | 4e-32 | A0A3P6ER49_BRAOL; Uncharacterized protein | ||||
STRING | Bo7g065010.1 | 7e-33 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7967 | 13 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36160.1 | 3e-30 | NAC domain containing protein 76 |
Publications ? help Back to Top | |||
---|---|---|---|
|