PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G36160.1 | ||||||||
Common Name | ANAC076, F23E13.50, NAC076, VND2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 377aa MW: 43516.8 Da PI: 6.6098 | ||||||||
Description | NAC domain containing protein 76 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 179.4 | 9.5e-56 | 10 | 139 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++ ++ e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ AT4G36160.1 10 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEscRIGYeERNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD- 105 69****************************.9***************953533332556**************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrle 129 k++l+g++ktLvfykgrap+g+ktdW+mheyrle AT4G36160.1 106 KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 139 999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.89E-61 | 7 | 159 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.585 | 10 | 159 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.4E-29 | 11 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:0071555 | Biological Process | cell wall organization | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000039 | anatomy | shoot axis vascular system | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0003011 | anatomy | root vascular system | ||||
PO:0003015 | anatomy | primary root differentiation zone | ||||
PO:0005352 | anatomy | xylem | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025257 | anatomy | primary root elongation zone | ||||
PO:0025275 | anatomy | procambium | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 377 aa Download sequence Send to blast |
MESVDQSCSV PPGFRFHPTD EELVGYYLRK KVASQKIDLD VIRDIDLYRI EPWDLQESCR 60 IGYEERNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAVYDKSKLI GMRKTLVFYK 120 GRAPNGQKTD WIMHEYRLES DENAPPQEEG WVVCRAFKKK PMTGQAKNTE TWSSSYFYDE 180 LPSGVRSVTE PLNYVSKQKQ NVFAQDLMFK QELEGSDIGL NFIHCDQFIQ LPQLESPSLP 240 LTKRPVSLTS ITSLEKNKNI YKRHLIEEDV SFNALISSGN KDKKKKKTSV MTTDWRALDK 300 FVASQLMSQE DGVSGFGGHH EEDNNKIGHY NNEESNNKGS VETASSTLLS DREEENRFIS 360 GLLCSNLDYD LYRDLHV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-50 | 4 | 160 | 9 | 169 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 42567446 | 0.0 | ||||
Genevisible | 253076_at | 0.0 | ||||
Expression Atlas | AT4G36160 | - | ||||
AtGenExpress | AT4G36160 | - | ||||
ATTED-II | AT4G36160 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}. | |||||
Uniprot | TISSUE SPECIFICITY: Detected in root protoxylem and metaxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls (PubMed:18445131). Expressed in roots, hypocotyls, cotyledons and leaves. Present in developing xylems (PubMed:16103214, PubMed:16581911). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a NAC-domain transcription factor. Expressed in the vascular tissue. | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00471 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G36160.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT5G13180 | |||||
IntAct | Search O65508 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G36160 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AL022141 | 0.0 | AL022141.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F23E13 (ESSAII project). | |||
GenBank | AL161588 | 0.0 | AL161588.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84. | |||
GenBank | CP002687 | 0.0 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001329497.1 | 0.0 | NAC domain containing protein 76 | ||||
Swissprot | O65508 | 0.0 | NAC76_ARATH; NAC domain-containing protein 76 | ||||
TrEMBL | A0A1P8B7X6 | 0.0 | A0A1P8B7X6_ARATH; NAC domain containing protein 76 | ||||
STRING | AT4G36160.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3686 | 26 | 61 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G36160.1 |
Entrez Gene | 829773 |
iHOP | AT4G36160 |
wikigenes | AT4G36160 |