PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_41930.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 68aa MW: 8188.13 Da PI: 4.3441 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 24.1 | 6.3e-08 | 33 | 67 | 6 | 40 |
S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS- CS Homeobox 6 tftkeqleeLeelFeknrypsaeereeLAkklgLt 40 ++t+eq+ Le+ Fe ++++ e++++LAk lgL Rsa1.0_41930.1_g00001.1 33 NLTHEQVPLLEKSFETENKLEPERKTQLAKMLGLR 67 789******************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.89E-6 | 31 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.26E-4 | 33 | 66 | No hit | No description |
Pfam | PF00046 | 4.4E-5 | 33 | 67 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-7 | 34 | 67 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MNMEESSKRR PFYCSPDDLL YDYDYYDEQT PDNLTHEQVP LLEKSFETEN KLEPERKTQL 60 AKMLGLRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_41930.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018453925.1 | 8e-43 | PREDICTED: homeobox-leucine zipper protein HAT5-like | ||||
Swissprot | Q02283 | 1e-18 | HAT5_ARATH; Homeobox-leucine zipper protein HAT5 | ||||
TrEMBL | A0A087H661 | 2e-24 | A0A087H661_ARAAL; Uncharacterized protein | ||||
TrEMBL | A0A087H662 | 2e-24 | A0A087H662_ARAAL; Uncharacterized protein | ||||
STRING | A0A087H661 | 3e-25 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM545 | 28 | 143 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01470.1 | 3e-20 | homeobox 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|