PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_19328.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 103aa MW: 11528 Da PI: 4.1087 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 85.7 | 6.3e-27 | 28 | 86 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+ ++e++sws+ +nsfvv++ +efak+ LpkyFkh+nf+SFvRQLn+Y Rsa1.0_19328.1_g00001.1 28 FLSKTYDMVDDPMTDEVVSWSSGNNSFVVWNVTEFAKQFLPKYFKHNNFSSFVRQLNTY 86 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 7.7E-28 | 22 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 7.48E-24 | 23 | 87 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.4E-23 | 24 | 100 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.9E-15 | 28 | 51 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 9.1E-22 | 28 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.9E-15 | 66 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.9E-15 | 79 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MGSICESVPT VNSSSPSATV VVNSIPPFLS KTYDMVDDPM TDEVVSWSSG NNSFVVWNVT 60 EFAKQFLPKY FKHNNFSSFV RQLNTYVSID QSIVFDVPEE CLC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 6e-20 | 15 | 92 | 17 | 98 | Heat shock factor protein 1 |
5d5v_B | 6e-20 | 15 | 92 | 17 | 98 | Heat shock factor protein 1 |
5d5v_D | 6e-20 | 15 | 92 | 17 | 98 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_19328.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189185 | 3e-77 | AC189185.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB001H24, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018491796.1 | 2e-53 | PREDICTED: heat stress transcription factor A-1e-like | ||||
Swissprot | Q9SCW5 | 2e-43 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
TrEMBL | A0A397ZZQ7 | 2e-45 | A0A397ZZQ7_BRACM; Uncharacterized protein | ||||
STRING | Bra001071.1-P | 5e-46 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM965 | 28 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G02990.1 | 7e-46 | heat shock transcription factor A1E |
Publications ? help Back to Top | |||
---|---|---|---|
|