PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_06785.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 164aa MW: 18532.7 Da PI: 6.5026 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 107.2 | 1.1e-33 | 26 | 92 | 52 | 118 |
CG-1 52 kDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118 kDG++w+kkkdgktv+E+hekLKvg+++vl+cyYah+e+n+++q cyw+Le+el +iv+v+ylevk Rsa1.0_06785.1_g00002.1 26 KDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENLQMWCYWMLEQELMHIVFVQYLEVK 92 9***************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01076 | 1.0E-24 | 1 | 92 | IPR005559 | CG-1 DNA-binding domain |
PROSITE profile | PS51437 | 44.174 | 1 | 97 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 7.3E-27 | 25 | 91 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MYSSLAPYLS SSRSAILDID CFELLKDGHN WRKKKDGKTV KEAHEKLKVG SIDVLHCYYA 60 HGEDNENLQM WCYWMLEQEL MHIVFVQYLE VKGNRISSSG IKENNSNSLS GSTSVNIDST 120 AHTSSKSSPL CEDANSGNRD CWIHGNIVKE NDSQRLVGVL PRHD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_06785.1_g00002.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009112123.1 | 9e-79 | PREDICTED: calmodulin-binding transcription activator 2 | ||||
Refseq | XP_013661269.1 | 8e-79 | calmodulin-binding transcription activator 2-like | ||||
Refseq | XP_013661296.1 | 8e-79 | calmodulin-binding transcription activator 2-like | ||||
Swissprot | Q6NPP4 | 1e-59 | CMTA2_ARATH; Calmodulin-binding transcription activator 2 | ||||
TrEMBL | A0A3P5XW09 | 1e-77 | A0A3P5XW09_BRACM; Uncharacterized protein | ||||
STRING | Bra037769.1-P | 2e-78 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM19280 | 4 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G09410.1 | 1e-64 | ethylene induced calmodulin binding protein |
Publications ? help Back to Top | |||
---|---|---|---|
|