PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_05241.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 76aa MW: 8596.85 Da PI: 9.9442 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 101.3 | 3.7e-32 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey++ Rsa1.0_05241.1_g00003.1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAN 74 79***********************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.1E-40 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.249 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.24E-30 | 17 | 75 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.46E-38 | 17 | 75 | No hit | No description |
PRINTS | PR00404 | 1.2E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MEGGASDEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VIFSTRGRLY EYANNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-21 | 16 | 74 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_05241.1_g00003.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189588 | 1e-109 | AC189588.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH012N11, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001303136.1 | 3e-47 | agamous-like MADS-box protein AGL5 | ||||
Refseq | XP_009142866.1 | 3e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_009142867.1 | 3e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013632198.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632199.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632200.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632201.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632202.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632203.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632204.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632205.1 | 6e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_013632206.1 | 3e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013632207.1 | 3e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013673080.1 | 3e-47 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013673081.1 | 3e-47 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013673082.1 | 3e-47 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013691073.1 | 3e-47 | agamous-like MADS-box protein AGL5 | ||||
Refseq | XP_018514277.1 | 7e-47 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_022557364.1 | 1e-47 | agamous-like MADS-box protein AGL5 | ||||
Refseq | XP_022574676.1 | 3e-47 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Swissprot | P29385 | 2e-47 | AGL5_ARATH; Agamous-like MADS-box protein AGL5 | ||||
TrEMBL | A0A0D3BPE6 | 3e-47 | A0A0D3BPE6_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3N6S4E1 | 3e-47 | A0A3N6S4E1_BRACR; Uncharacterized protein | ||||
STRING | Bra004716.1-P | 1e-46 | (Brassica rapa) | ||||
STRING | Bo4g017290.1 | 4e-48 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42830.2 | 6e-37 | MIKC_MADS family protein |