PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05232.1_g00002.1
Organism
Raphanus sativus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 58aa    MW: 6811.77 Da    PI: 4.9113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05232.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM54.83.3e-171157148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             +ppGfrFhPt+eel+++yL+kk+++ k++l +vi++vd++k+ePwd++
  Rsa1.0_05232.1_g00002.1 11 VPPGFRFHPTEEELLQYYLRKKISNIKIDL-DVIRDVDLNKLEPWDIQ 57
                             69****************************.9**************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-18757IPR003441NAC domain
PROSITE profilePS5100520.0111158IPR003441NAC domain
PfamPF023651.7E-81254IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 58 aa     Download sequence    Send to blast
MNISVNGQSQ VPPGFRFHPT EEELLQYYLR KKISNIKIDL DVIRDVDLNK LEPWDIQG
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues such as tracheary elements. {ECO:0000269|PubMed:16214898}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_05232.1_g00002.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1386424e-69AL138642.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F21F14.
GenBankCP0026864e-69CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544875.11e-33PREDICTED: NAC domain-containing protein 43
SwissprotQ9M2745e-32NAC66_ARATH; NAC domain-containing protein 66
TrEMBLA0A0D3CTA82e-33A0A0D3CTA8_BRAOL; Uncharacterized protein
TrEMBLA0A1J3D7C58e-32A0A1J3D7C5_NOCCA; NAC domain-containing protein 66 (Fragment)
TrEMBLA0A1J3FHU58e-32A0A1J3FHU5_NOCCA; NAC domain-containing protein 43 (Fragment)
STRINGXP_010544875.14e-33(Tarenaya hassleriana)
STRINGBo6g066300.14e-34(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61910.12e-34NAC domain protein 66
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]