PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G61910.1 | ||||||||
Common Name | ANAC066, F21F14.80, NAC066, NST2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 334aa MW: 37861.7 Da PI: 6.0435 | ||||||||
Description | NAC domain protein 66 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.9 | 2.9e-51 | 11 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +ppGfrFhPt+eel+++yL+kk+++ k++l +vi+++d++k+ePwd+++ k+ + +++wyf+s++dkky+tg+r+nrat+ g+Wkatg+dk++++ AT3G61910.1 11 VPPGFRFHPTEEELLKYYLRKKISNIKIDL-DVIPDIDLNKLEPWDIQEmcKIGTtPQNDWYFYSHKDKKYPTGTRTNRATTVGFWKATGRDKTIYT- 106 69****************************.9***************962433332455**************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g +g++ktLvfykgrap+g+k+dW+mheyrl AT3G61910.1 107 NGDRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139 9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.2E-55 | 8 | 175 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.615 | 11 | 175 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.8E-27 | 12 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0009901 | Biological Process | anther dehiscence | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016020 | Cellular Component | membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000002 | anatomy | anther wall | ||||
PO:0000056 | anatomy | flower bud | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 334 aa Download sequence Send to blast |
MNISVNGQSQ VPPGFRFHPT EEELLKYYLR KKISNIKIDL DVIPDIDLNK LEPWDIQEMC 60 KIGTTPQNDW YFYSHKDKKY PTGTRTNRAT TVGFWKATGR DKTIYTNGDR IGMRKTLVFY 120 KGRAPHGQKS DWIMHEYRLD ESVLISSCGD HDVNVETCDV IGSDEGWVVC RVFKKNNLCK 180 NMISSSPASS VKTPSFNEET IEQLLEVMGQ SCKGEIVLDP FLKLPNLECH NNTTITSYQW 240 LIDDQVNNCH VSKVMDPSFI TSWAALDRLV ASQLNGPNSY SIPAVNETSQ SPYHGLNRSG 300 CNTGLTPDYY IPEIDLWNEA DFARTTCHLL NGSG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-45 | 8 | 177 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-45 | 8 | 177 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-45 | 8 | 177 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-45 | 8 | 177 | 14 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-45 | 8 | 177 | 17 | 170 | NAC domain-containing protein 19 |
4dul_A | 1e-45 | 8 | 177 | 14 | 167 | NAC domain-containing protein 19 |
4dul_B | 1e-45 | 8 | 177 | 14 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 18412192 | 0.0 | ||||
Genevisible | 251303_at | 0.0 | ||||
Expression Atlas | AT3G61910 | - | ||||
AtGenExpress | AT3G61910 | - | ||||
ATTED-II | AT3G61910 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in anthers. Also present in pollen, base of siliques and inflorescence stems. {ECO:0000269|PubMed:16214898}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | NAC transcription factor NST2. NST1 and NST2 are redundant in regulating secondary wall thickening in anther walls. NST2 promoter was particularly strong in anther tissue. | |||||
UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues such as tracheary elements. {ECO:0000269|PubMed:16214898}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00015 | PBM | 25378322 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G61910.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator (A: Activate/R: Repress) | |||||
ATRM | AT3G13890 (A) |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT5G12870(A), AT5G56110(A) |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G61910 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY084323 | 0.0 | AY084323.1 Arabidopsis thaliana clone 103969 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_191750.1 | 0.0 | NAC domain protein 66 | ||||
Swissprot | Q9M274 | 0.0 | NAC66_ARATH; NAC domain-containing protein 66 | ||||
TrEMBL | A0A178VKW7 | 0.0 | A0A178VKW7_ARATH; NST2 | ||||
STRING | AT3G61910.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM778 | 28 | 124 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G61910.1 |
Entrez Gene | 825364 |
iHOP | AT3G61910 |
wikigenes | AT3G61910 |