PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_04499.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 91aa MW: 10010.1 Da PI: 4.6439 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 39.4 | 1.5e-12 | 42 | 78 | 1 | 37 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskk 37 rW++ e+laL+++r+em++++r++ lk plWee+s++ Rsa1.0_04499.1_g00001.1 42 RWPRPETLALLRIRSEMNKTFRDSTLKTPLWEEISRF 78 8**********************************97 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MSGDSSGLLD SSRGGGVGGS GEEEKDIKME ETGDVGGGGG NRWPRPETLA LLRIRSEMNK 60 TFRDSTLKTP LWEEISRFYT FSDVSILSYF R |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_04499.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018478956.1 | 2e-45 | PREDICTED: trihelix transcription factor GT-2-like isoform X1 | ||||
Swissprot | Q39117 | 8e-21 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
TrEMBL | A0A3N6R2J8 | 7e-24 | A0A3N6R2J8_BRACR; Uncharacterized protein (Fragment) | ||||
STRING | XP_010533325.1 | 4e-22 | (Tarenaya hassleriana) | ||||
STRING | A0A087HJ00 | 5e-22 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM29141 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76890.2 | 1e-19 | Trihelix family protein |