PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_03990.1_g00005.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 157aa MW: 18232.9 Da PI: 10.3018 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 165.5 | 1.8e-51 | 18 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 lp+GfrFhP+d+elv++yL ++ ++ + v+ evd++++ePwd+p++++ + kewyf+s++d+kyatg+r+nrat++gyWkat Rsa1.0_03990.1_g00005.1 18 LPRGFRFHPRDDELVCDYLMRRNVRSLYQP-VVLIEVDLNQCEPWDIPQTARVGGKEWYFYSQKDRKYATGQRTNRATATGYWKAT 102 799****************99866666555.4899*************9889999******************************* PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 gkd+++ + +g+lvg++ktLvfy+grapkg+ktdWvmhe+rl Rsa1.0_03990.1_g00005.1 103 GKDRAIQR-NGSLVGMRKTLVFYRGRAPKGHKTDWVMHEFRL 143 ******99.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.45E-54 | 10 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.304 | 18 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.1E-26 | 19 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MDAGEENKGS ISMVEAKLPR GFRFHPRDDE LVCDYLMRRN VRSLYQPVVL IEVDLNQCEP 60 WDIPQTARVG GKEWYFYSQK DRKYATGQRT NRATATGYWK ATGKDRAIQR NGSLVGMRKT 120 LVFYRGRAPK GHKTDWVMHE FRLQGTSIHH SPKVMIV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-47 | 14 | 143 | 11 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_03990.1_g00005.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB026645 | 9e-82 | AB026645.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGH6. | |||
GenBank | CP002686 | 9e-82 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018489038.1 | 1e-113 | PREDICTED: NAC domain-containing protein 21/22 | ||||
Swissprot | Q84TE6 | 1e-81 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A078J914 | 1e-104 | A0A078J914_BRANA; BnaA05g26240D protein | ||||
TrEMBL | A0A3N6QDS1 | 1e-104 | A0A3N6QDS1_BRACR; Uncharacterized protein | ||||
TrEMBL | A0A3P5Z100 | 1e-104 | A0A3P5Z100_BRACM; Uncharacterized protein | ||||
STRING | Bra034713.1-P | 1e-104 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3619 | 28 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12977.1 | 1e-103 | NAC family protein |