PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_03799.1_g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 245aa MW: 28280 Da PI: 7.4982 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 100.4 | 2.5e-31 | 15 | 88 | 53 | 127 |
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 +e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+ +++l+g++ktLvfy+grap+g+k+dW++hey Rsa1.0_03799.1_g00001.1 15 EEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYL-NSKLIGMRKTLVFYRGRAPNGQKSDWIIHEYY 88 4678**************************************.999***************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 36.953 | 1 | 111 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 8.37E-35 | 15 | 111 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-13 | 18 | 87 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048759 | Biological Process | xylem vessel member cell differentiation | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MILDTRVERC RIGYEEQNEW YFFSHKDKKY PTGTRTNRAT MAGFWKATGR DKAVYLNSKL 60 IGMRKTLVFY RGRAPNGQKS DWIIHEYYSL ESHQNAPPQE EGWVVCRAFK KRTTTVPTKR 120 RQLWDPNCFL YDDATLLEPL DKNVLTKRAK HNTDGLAVTP FKQELPFEAN QIVDDGLFGS 180 MYLKSMGDDE LSQLPQLESP SLASEKLSET ISRAGEDEVG AEKRMTDWRA LDKFVASQFL 240 MSGEE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-29 | 17 | 115 | 70 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-29 | 17 | 115 | 70 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-29 | 17 | 115 | 70 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-29 | 17 | 115 | 70 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swm_B | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swm_C | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swm_D | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swp_A | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swp_B | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swp_C | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
3swp_D | 3e-29 | 17 | 115 | 73 | 172 | NAC domain-containing protein 19 |
4dul_A | 3e-29 | 17 | 115 | 70 | 169 | NAC domain-containing protein 19 |
4dul_B | 3e-29 | 17 | 115 | 70 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00590 | DAP | Transfer from AT5G66300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_03799.1_g00001.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738278 | 0.0 | KF738278.1 Brassica napus NAC transcription factor 105 (NAC105.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018463816.1 | 1e-180 | PREDICTED: NAC domain-containing protein 105-like | ||||
Swissprot | Q9FH59 | 1e-133 | NC105_ARATH; NAC domain-containing protein 105 | ||||
TrEMBL | A0A0A7DNJ5 | 1e-166 | A0A0A7DNJ5_BRANA; NAC transcription factor 105 | ||||
STRING | Bo7g065010.1 | 1e-165 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15134 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66300.1 | 1e-114 | NAC domain containing protein 105 |
Publications ? help Back to Top | |||
---|---|---|---|
|