PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Rsa1.0_02678.1_g00002.1

Organism

Raphanus sativus

Taxonomic ID

3726

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus

Family

G2-like

Protein Properties

Length: 267aa MW: 30293.7 Da PI: 10.787

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Rsa1.0_02678.1_g00002.1	genome	RGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	91.9	5.5e-29	215	264	2	51
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ Rsa1.0_02678.1_g00002.1 215 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 264 9************************************************* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.023	211	267	IPR017930	Myb domain
SuperFamily	SSF46689	1.7E-13	212	264	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.9E-25	213	264	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.6E-21	215	265	IPR006447	Myb domain, plants
Pfam	PF00249	3.8E-6	216	266	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 267 aa Download sequence Send to blast
MSMEGVFLEK PNTTTTLPDL SLNISLPDSH HHLHRNELSR RSSQTDNRSS NFEVSLSHHN 60 NPSSNPSTRI LHCPDRRNLN LSHHQHYNNN PILNGGSLHH RVDESEINNT HRPIRGIPVY 120 HNRSFPFHQQ TSHSSSLGGG DLDQSSILNS SSGYNNAYRS LQSSPRLKGV PVHHHHNHYG 180 VVRSSDSSSP HHHHHGMIRS RFLPKMPTKR SMRAPRMRWT SSLHARFVHA VELLGGHERA 240 TPKSVLELMD VKDLTLAHVK SHLQVNL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	1e-13	216	264	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	1e-13	216	264	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	1e-13	216	264	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	1e-13	216	264	3	51	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	2e-13	216	264	4	52	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Rsa1.0_02678.1_g00002.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY030192	0.0	AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBank	AY048688	0.0	AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBank	BT026436	0.0	BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018471151.1	0.0	PREDICTED: LOW QUALITY PROTEIN: transcription repressor KAN1-like
Swissprot	Q93WJ9	1e-122	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	A0A078HI30	1e-151	A0A078HI30_BRANA; BnaC02g06680D protein
TrEMBL	A0A0D3AJD1	1e-151	A0A0D3AJD1_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6DAV4	1e-151	A0A3P6DAV4_BRAOL; Uncharacterized protein
STRING	Bo2g013140.1	1e-152	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6606	26	45

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16560.1	1e-109	G2-like family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]