PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00826.1_g00011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 88aa MW: 9840.02 Da PI: 4.3077 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 39.3 | 8.5e-13 | 1 | 31 | 21 | 51 |
HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51 +KKA+ELS+LCda+v i+fsstg +y +ss Rsa1.0_00826.1_g00011.1 1 MKKANELSILCDAKVGDIVFSSTGMVYYFSS 31 8**************************9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00319 | 7.9E-10 | 1 | 29 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 0.0047 | 1 | 32 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 13.904 | 1 | 33 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-13 | 1 | 44 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MKKANELSIL CDAKVGDIVF SSTGMVYYFS SEGMEHILSK YGYSAATSGH RQKEEQQLLL 60 CSSQDNGDLL WTDESLTSEL ERLQLAIE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00826.1_g00011.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018438874.1 | 2e-58 | PREDICTED: agamous-like MADS-box protein AGL18 | ||||
Swissprot | Q9M2K8 | 3e-30 | AGL18_ARATH; Agamous-like MADS-box protein AGL18 | ||||
TrEMBL | A0A078H2B3 | 2e-41 | A0A078H2B3_BRANA; BnaC04g24260D protein | ||||
STRING | Bo4g111230.1 | 4e-40 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM37483 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57390.1 | 1e-32 | AGAMOUS-like 18 |