PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00703.1_g00016.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 118aa MW: 13499.2 Da PI: 10.5777 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 89.3 | 5.4e-28 | 19 | 75 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+++NaKQy++Il+RRq+Rakl+++++ +s+kpy+heSRh h ++R Rg+gGrF Rsa1.0_00703.1_g00016.1 19 EEPFFINAKQYHGILRRRQSRAKLAARNRA-MQSKKPYMHESRHLHEINRLRGCGGRF 75 69****************************.9*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-29 | 17 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 32.49 | 18 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.6E-23 | 20 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-20 | 21 | 43 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.1E-20 | 52 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MQLMGIHQQV VPLQCDAVEE PFFINAKQYH GILRRRQSRA KLAARNRAMQ SKKPYMHESR 60 HLHEINRLRG CGGRFFNAKK KNGGRKEEEE ETTSDENTSE ASSSLRSEKS AMAPNGRS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 9e-20 | 18 | 82 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00703.1_g00016.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018434609.1 | 8e-71 | PREDICTED: nuclear transcription factor Y subunit A-4 | ||||
Refseq | XP_018434610.1 | 8e-71 | PREDICTED: nuclear transcription factor Y subunit A-4 | ||||
Swissprot | Q8VY64 | 5e-63 | NFYA4_ARATH; Nuclear transcription factor Y subunit A-4 | ||||
TrEMBL | A0A3P6BXA1 | 1e-66 | A0A3P6BXA1_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g039370.1 | 1e-66 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4168 | 27 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34720.1 | 3e-47 | nuclear factor Y, subunit A4 |
Publications ? help Back to Top | |||
---|---|---|---|
|