PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G34720.1

Common Name

NFYA4, NF-YA4, T29F13.7

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YA

Protein Properties

Length: 198aa MW: 22258.7 Da PI: 9.2692

Description

nuclear factor Y, subunit A4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G34720.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CBFB_NFYA	100.3	2e-31	97	153	1	58
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rakle++++ +k++kpy+heSRh hA+rRpRg+gGrF AT2G34720.1 97 EEPVFVNAKQYHGILRRRQSRAKLEARNRA-IKAKKPYMHESRHLHAIRRPRGCGGRF 153 69**************************.************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00521	2.9E-35	95	156	IPR001289	Nuclear transcription factor Y subunit A
PROSITE profile	PS51152	36.988	96	156	IPR001289	Nuclear transcription factor Y subunit A
Pfam	PF02045	3.4E-26	98	153	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	9.8E-24	99	121	IPR001289	Nuclear transcription factor Y subunit A
PROSITE pattern	PS00686	0	101	121	IPR018362	CCAAT-binding factor, conserved site
PRINTS	PR00616	9.8E-24	130	153	IPR001289	Nuclear transcription factor Y subunit A

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0048510	Biological Process	regulation of timing of transition from vegetative to reproductive phase
GO:0005634	Cellular Component	nucleus
GO:0016602	Cellular Component	CCAAT-binding factor complex
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell

Sequence ? help Back to Top
Protein Sequence Length: 198 aa Download sequence Send to blast
MTSSVHELSD NNESHAKKER PDSQTRPQVP SGRSSESIDT NSVYSEPMAH GLYPYPDPYY 60 RSVFAQQAYL PHPYPGVQLQ LMGMQQPGVP LQCDAVEEPV FVNAKQYHGI LRRRQSRAKL 120 EARNRAIKAK KPYMHESRHL HAIRRPRGCG GRFLNAKKEN GDHKEEEEAT SDENTSEASS 180 SLRSEKLAMA TSGPNGRS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4awl_A	5e-20	96	166	1	71	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.37769	0.0	flower\| root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186505349	0.0
Genevisible	267315_at	0.0
Expression Atlas	AT2G34720	-
AtGenExpress	AT2G34720	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stems, caulines, and senescent flowers. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G34720.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G10800, AT3G48590, AT4G14540, AT5G50480, AT5G63470, AT1G08970, AT1G54830, AT1G56170
IntAct	Search Q8VY64

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G34720

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY072414	0.0	AY072414.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds.
GenBank	AY114711	0.0	AY114711.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_850235.1	1e-146	nuclear factor Y, subunit A4
Swissprot	Q8VY64	1e-147	NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBL	A0A178VWS5	1e-145	A0A178VWS5_ARATH; NF-YA4
STRING	AT2G34720.1	1e-146	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4168	27	56
Representative plant	OGRP680	16	72

Link Out ? help Back to Top
Phytozome	AT2G34720.1
Entrez Gene	818037
iHOP	AT2G34720
wikigenes	AT2G34720

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Koroleva OA,Tomlinson ML,Leader D,Shaw P,Doonan JH High-throughput protein localization in Arabidopsis using Agrobacterium-mediated transient expression of GFP-ORF fusions. Plant J., 2005. 41(1): p. 162-74 [PMID:15610358] Wenkel S, et al. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell, 2006. 18(11): p. 2971-84 [PMID:17138697] Bi YM,Wang RL,Zhu T,Rothstein SJ Global transcription profiling reveals differential responses to chronic nitrogen stress and putative nitrogen regulatory components in Arabidopsis. BMC Genomics, 2007. 8: p. 281 [PMID:17705847] Yamamoto A, et al. Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors. Plant J., 2009. 58(5): p. 843-56 [PMID:19207209] Liu JX,Howell SH bZIP28 and NF-Y transcription factors are activated by ER stress and assemble into a transcriptional complex to regulate stress response genes in Arabidopsis. Plant Cell, 2010. 22(3): p. 782-96 [PMID:20207753] Shin R,Jez JM,Basra A,Zhang B,Schachtman DP 14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Hackenberg D, et al. Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]