PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8549_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB_related
Protein Properties Length: 88aa    MW: 10076.5 Da    PI: 9.7477
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8549_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +v+++G g W+t + + g++R++k+c++rw +yl
       RrC8549_p1 14 KGAWTQEEDHKLISYVQRHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129422.91965IPR017930Myb domain
SMARTSM007171.6E-111363IPR001005SANT/Myb domain
PfamPF002495.6E-171461IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-221588IPR009057Homeodomain-like
CDDcd001671.43E-81661No hitNo description
Gene3DG3DSA:1.10.10.606.9E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MVRTPCCRAE GLKKGAWTQE EDHKLISYVQ RHGEGGWRTL PDKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF SQAEEDSIIS LHAIHGNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-141288580B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in glucosinolates biosynthesis. {ECO:0000269|PubMed:23580754, ECO:0000269|PubMed:23943862}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701201e-116KJ670120.1 Brassica napus MYB transcription factor 122 (MYB122.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106064.13e-57PREDICTED: transcription factor MYB122-like
SwissprotQ9C9C88e-58MY122_ARATH; Transcription factor MYB122
TrEMBLA0A3P6BA857e-56A0A3P6BA85_BRACM; Uncharacterized protein
STRINGBo6g118350.12e-56(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.14e-60myb domain protein 122
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Guo R, et al.
    Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(18): p. 5707-19
    [PMID:24151308]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Frerigmann H,Gigolashvili T
    MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana.
    Mol Plant, 2014. 7(5): p. 814-28
    [PMID:24431192]
  5. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  6. Peskan-Berghöfer T, et al.
    Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
    New Phytol., 2015. 208(3): p. 873-86
    [PMID:26075497]
  7. Frerigmann H,Glawischnig E,Gigolashvili T
    The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana.
    Front Plant Sci, 2015. 6: p. 654
    [PMID:26379682]
  8. Frerigmann H, et al.
    Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products.
    Mol Plant, 2016. 9(5): p. 682-695
    [PMID:26802248]
  9. Stahl E, et al.
    Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance.
    Mol Plant, 2016. 9(5): p. 662-681
    [PMID:26802249]
  10. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  11. Xu J, et al.
    Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity.
    Plant Cell, 2016. 28(5): p. 1144-62
    [PMID:27081184]
  12. Miao H, et al.
    Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation.
    Sci Rep, 2016. 6: p. 31854
    [PMID:27549907]