PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC717_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 188aa MW: 21566.7 Da PI: 4.6077 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.5 | 2.6e-17 | 27 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE+e ++++++ +G++ W++Ia++++ gRt++++k+ w+++l RrC717_p1 27 RGNFSAEEEEMIIKLHQSYGNK-WSKIASKLP-GRTDNEIKNVWHTHL 72 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.72E-22 | 10 | 80 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 9.4E-9 | 12 | 34 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.191 | 22 | 76 | IPR017930 | Myb domain |
SMART | SM00717 | 7.3E-16 | 26 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 27 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.57E-11 | 29 | 72 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-24 | 35 | 73 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MRTGDLSPNN LSCRLRWINY LRPDVKRGNF SAEEEEMIIK LHQSYGNKWS KIASKLPGRT 60 DNEIKNVWHT HLKKRLVQSS ENADEPASPS ASDCGSRGKV DKPDLLEIPF DSELDIWSFL 120 DDSTANANSS VSRAEEESDE DEVKKWLKHL ESELGLEEDD NHQHLKEEEQ DKDSSISSLL 180 NTYELMIH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-15 | 12 | 76 | 44 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189209 | 5e-62 | AC189209.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB007M04, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013652543.1 | 6e-89 | transcription factor MYB63 | ||||
Swissprot | Q9SA47 | 4e-66 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | A0A3N6SDE0 | 2e-97 | A0A3N6SDE0_BRACR; Uncharacterized protein | ||||
STRING | Bra035097.1-P | 3e-88 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 2e-68 | myb domain protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|