PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC4863_p5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 138aa MW: 16080.7 Da PI: 10.5127 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.4 | 1.1e-15 | 14 | 59 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W Ed l ++v+ +G+ +W+ Ia++m+ gRt+k+c++rw++ RrC4863_p5 14 RGHWRISEDSHLMELVAVYGPQNWNHIAEKMQ-GRTGKSCRLRWFNQ 59 789999**************************.***********996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.835 | 9 | 64 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-9 | 13 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-15 | 14 | 59 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.94E-22 | 14 | 105 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.4E-23 | 15 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.33E-10 | 17 | 58 | No hit | No description |
SMART | SM00717 | 25 | 65 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-8 | 68 | 104 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MNQKEEACFR VCSRGHWRIS EDSHLMELVA VYGPQNWNHI AEKMQGRTGK SCRLRWFNQL 60 DPRINKRAFN LGEEERLFAA HRGFGNKCAM IAKLFNGRTD DAFKEPQAYV LMARKLRKLI 120 KNLSTPAIII KVPVSDRY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-23 | 14 | 104 | 4 | 94 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 3e-23 | 13 | 104 | 26 | 117 | MYB TRANSFORMING PROTEIN |
1mse_C | 2e-23 | 14 | 104 | 4 | 94 | C-Myb DNA-Binding Domain |
1msf_C | 2e-23 | 14 | 104 | 4 | 94 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018478826.1 | 2e-98 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9SEZ4 | 6e-49 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | A0A087GV70 | 2e-59 | A0A087GV70_ARAAL; Uncharacterized protein | ||||
TrEMBL | R0FTE6 | 3e-59 | R0FTE6_9BRAS; Uncharacterized protein | ||||
STRING | A0A087GV70 | 3e-60 | (Arabis alpina) | ||||
STRING | XP_006292843.1 | 6e-60 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6300 | 18 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G29020.1 | 1e-62 | myb domain protein 110 |
Publications ? help Back to Top | |||
---|---|---|---|
|