PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC42619_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 168aa MW: 19001.8 Da PI: 10.7147 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 90.9 | 1.1e-28 | 4 | 57 | 2 | 56 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 ++++WtpeLH+rFveaveqL G ekA+P++ilelm+v++Lt+++v+SHLQkYR++ RrC42619_p1 4 KKVDWTPELHRRFVEAVEQL-GLEKAVPSRILELMGVHCLTRHNVASHLQKYRSH 57 689*****************.********************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.076 | 1 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.43E-18 | 4 | 60 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.4E-27 | 4 | 60 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.2E-26 | 4 | 57 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.7E-8 | 6 | 55 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MCAKKVDWTP ELHRRFVEAV EQLGLEKAVP SRILELMGVH CLTRHNVASH LQKYRSHRKH 60 LLAREAEAAN WTRKRHIYGL DSAGVNTNGR NKNGWIAPAP TIGYAPPPPA AVASPTVHHH 120 QFRPLHVWGH PTVNQSVIPH MFAKHLPPPS NAMATPPFWV SDTPYWPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 5e-16 | 5 | 59 | 3 | 57 | Transcription factor LUX |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018434345.1 | 1e-118 | PREDICTED: transcription activator GLK1-like isoform X1 | ||||
Swissprot | Q9SIV3 | 8e-87 | GLK1_ARATH; Transcription activator GLK1 | ||||
TrEMBL | M4EQQ6 | 1e-101 | M4EQQ6_BRARP; Uncharacterized protein | ||||
STRING | Bra031129.1-P | 1e-102 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2209 | 27 | 73 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G20570.1 | 8e-83 | GBF's pro-rich region-interacting factor 1 |