PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC2940_p2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 197aa MW: 22659.3 Da PI: 6.9535 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.6 | 1.7e-30 | 105 | 163 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+++g++fpr+Y++C+ ++C vkkk+er++++p++v +tYeg+Hnh+ RrC2940_p2 105 LDDGYKWRKYGKKPIRGNPFPRHYHKCSNPNCIVKKKIERDTSNPEYVLTTYEGRHNHP 163 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.2E-27 | 99 | 165 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.08 | 100 | 165 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-25 | 102 | 165 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.8E-31 | 105 | 164 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.0E-22 | 106 | 163 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MIYPSNINPN FKDFGETFKF DDYDDDAFQM IMEGINLGDH SPTLSWTSSE KLLATEVTSP 60 LQSSLATSPI SLEIEDKDES KKRKRRKDDQ VIHVFKTKSI KEIALDDGYK WRKYGKKPIR 120 GNPFPRHYHK CSNPNCIVKK KIERDTSNPE YVLTTYEGRH NHPSPSVVYC DSDDFDLTSL 180 NTLSFQTHTS SYSHSAP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-24 | 105 | 166 | 17 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 2e-24 | 105 | 166 | 17 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 80 | 85 | KKRKRR |
2 | 80 | 86 | KKRKRRK |
3 | 81 | 86 | KRKRRK |
4 | 82 | 87 | RKRRKD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00270 | DAP | Transfer from AT2G21900 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM593160 | 0.0 | KM593160.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY92) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018438381.1 | 1e-140 | PREDICTED: probable WRKY transcription factor 59 | ||||
Swissprot | Q9SJ09 | 4e-82 | WRK59_ARATH; Probable WRKY transcription factor 59 | ||||
TrEMBL | A0A078J8R0 | 1e-126 | A0A078J8R0_BRANA; BnaA09g55920D protein | ||||
TrEMBL | A0A397Y4D8 | 1e-126 | A0A397Y4D8_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EQZ8 | 1e-126 | M4EQZ8_BRARP; Uncharacterized protein | ||||
STRING | Bra031221.1-P | 1e-127 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13835 | 17 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21900.1 | 9e-73 | WRKY DNA-binding protein 59 |