PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G21900.1 | ||||||||
Common Name | ATWRKY59, F7D8.22, WRKY59 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 202aa MW: 23253.6 Da PI: 6.09 | ||||||||
Description | WRKY DNA-binding protein 59 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.8 | 1.4e-30 | 108 | 166 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+++gs+fpr+Y++C+s++C+vkkk+er++++p+++ +tYeg+Hnh+ AT2G21900.1 108 LDDGYKWRKYGKKPITGSPFPRHYHKCSSPDCNVKKKIERDTNNPDYILTTYEGRHNHP 166 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.3E-28 | 101 | 168 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.529 | 103 | 168 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.83E-25 | 104 | 168 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.2E-31 | 108 | 167 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.4E-22 | 109 | 166 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MNYPSNPNPS STDFTEFFKF DDFDDTFEKI MEEIGREDHS SSPTLSWSSS EKLVAAEITS 60 PLQTSLATSP MSFEIGDKDE IKKRKRHKED PIIHVFKTKS SIDEKVALDD GYKWRKYGKK 120 PITGSPFPRH YHKCSSPDCN VKKKIERDTN NPDYILTTYE GRHNHPSPSV VYCDSDDFDL 180 NSLNNWSFQT ANTYSFSHSA PY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-23 | 96 | 169 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 2e-23 | 96 | 169 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 263893_at | 0.0 | ||||
Expression Atlas | AT2G21900 | - | ||||
AtGenExpress | AT2G21900 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | member of WRKY Transcription Factor; Group II-c | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00270 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G21900.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G10585 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G21900 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT025261 | 0.0 | BT025261.1 Arabidopsis thaliana At2g21900 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_850019.1 | 1e-148 | WRKY DNA-binding protein 59 | ||||
Swissprot | Q9SJ09 | 1e-149 | WRK59_ARATH; Probable WRKY transcription factor 59 | ||||
TrEMBL | Q1LYW5 | 1e-147 | Q1LYW5_ARATH; At2g21900 | ||||
STRING | AT2G21900.1 | 1e-148 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13835 | 17 | 26 | Representative plant | OGRP14 | 17 | 875 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G21900.1 |
Entrez Gene | 816726 |
iHOP | AT2G21900 |
wikigenes | AT2G21900 |
Publications ? help Back to Top | |||
---|---|---|---|
|