PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC25612_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 143aa MW: 16477.9 Da PI: 10.7957 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 55 | 97 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g+ T+eE+ l+++++++lG++ W++Ia++++ gRt++++k++w++ RrC25612_p1 55 GNITAEEQHLIIQLHAKLGNR-WSKIAKHLP-GRTDNEIKNFWRT 97 677******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 5.81E-15 | 48 | 109 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.5E-22 | 49 | 103 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.301 | 49 | 103 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-14 | 53 | 101 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-16 | 55 | 97 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.41E-12 | 58 | 97 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MKKTGRGKEI TSQKEEGRVR MGSWTMEEDL ILFNYMVKVF GIPSPKPLWP DVRQGNITAE 60 EQHLIIQLHA KLGNRWSKIA KHLPGRTDNE IKNFWRTKIQ RHIKLSSSTE TKNIRDCTGN 120 SQRSEMTTTD QGSSSKASIW PRV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 8e-13 | 50 | 103 | 52 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 8e-13 | 50 | 103 | 52 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 8e-13 | 50 | 103 | 52 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK118091 | 3e-63 | AK118091.1 Arabidopsis thaliana At3g01530 mRNA for putative transcription factor, complete cds, clone: RAFL19-34-G03. | |||
GenBank | AY088761 | 3e-63 | AY088761.1 Arabidopsis thaliana clone 94595 mRNA, complete sequence. | |||
GenBank | AY519582 | 3e-63 | AY519582.1 Arabidopsis thaliana MYB transcription factor (At3g01530) mRNA, complete cds. | |||
GenBank | BT005574 | 3e-63 | BT005574.1 Arabidopsis thaliana clone U50886 putative myb family transcription factor (At3g01530) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018489878.1 | 2e-61 | PREDICTED: transcription factor MYB57-like | ||||
Swissprot | Q9SSA1 | 4e-52 | MYB57_ARATH; Transcription factor MYB57 | ||||
TrEMBL | A0A3P5ZMF6 | 1e-56 | A0A3P5ZMF6_BRACM; Uncharacterized protein | ||||
TrEMBL | M4C9X6 | 1e-56 | M4C9X6_BRARP; Uncharacterized protein | ||||
STRING | Bra001005.1-P | 2e-57 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01530.1 | 2e-54 | myb domain protein 57 |