PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G01530.1 | ||||||||
Common Name | ATMYB57, F4P13.8, MYB57 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 206aa MW: 23716.8 Da PI: 10.0597 | ||||||||
Description | myb domain protein 57 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.3 | 5.5e-16 | 27 | 74 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd +l +++ +G g W+++a+ g++Rt+k+c++rw++yl AT3G01530.1 27 KGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 74 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.9 | 4.7e-18 | 80 | 123 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++ AT3G01530.1 80 RGNITEEEQLLIIQLHAKLGNR-WSKIAKHLP-GRTDNEIKNFWRT 123 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.864 | 22 | 74 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.98E-29 | 25 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.4E-12 | 26 | 76 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-14 | 27 | 74 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.5E-22 | 28 | 81 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.33E-8 | 29 | 74 | No hit | No description |
PROSITE profile | PS51294 | 25.259 | 75 | 129 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-16 | 79 | 127 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.5E-17 | 80 | 123 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-25 | 82 | 129 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.18E-12 | 84 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009062 | anatomy | gynoecium | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
METTMKKKGR VKATITSQKE EEGTVRKGPW TMEEDFILFN YILNHGEGLW NSVAKASGLK 60 RTGKSCRLRW LNYLRPDVRR GNITEEEQLL IIQLHAKLGN RWSKIAKHLP GRTDNEIKNF 120 WRTKIQRHMK VSSENMMNHQ HHCSGNSQSS GMTTQGSSGK AIDTAESFSQ AKTTTFNVVE 180 QQSNENYWNV EDLWPVHLLN GDHHVI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-29 | 1 | 127 | 1 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 42563407 | 0.0 | ||||
Genevisible | 259187_at | 0.0 | ||||
Expression Atlas | AT3G01530 | - | ||||
AtGenExpress | AT3G01530 | - | ||||
ATTED-II | AT3G01530 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed specifically in flowers. {ECO:0000269|PubMed:19325888}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Member of the R2R3 factor gene family. | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00324 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G01530.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | Gibberellin, Jasmonic acid |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype. Myb21 and myb57 double mutant has an intermediate sterility phenotype and petals that grew to a final height parallel to the pistil. Myb24 and myb57 double mutant has petals that grew to a final height parallel to the pistil. Myb21, myb24 and myb57 triple mutant has a strongly reduced fertility and an arrested growth of the petals that never grew out of the sepals. {ECO:0000269|PubMed:19325888}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G01530 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519582 | 0.0 | AY519582.1 Arabidopsis thaliana MYB transcription factor (At3g01530) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_186802.1 | 1e-154 | myb domain protein 57 | ||||
Swissprot | Q9SSA1 | 1e-155 | MYB57_ARATH; Transcription factor MYB57 | ||||
TrEMBL | A0A178VG23 | 1e-152 | A0A178VG23_ARATH; MYB57 | ||||
STRING | AT3G01530.1 | 1e-153 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G01530.1 |
Entrez Gene | 821113 |
iHOP | AT3G01530 |
wikigenes | AT3G01530 |