PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC21587_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 170aa MW: 18700.8 Da PI: 4.8608 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 59.3 | 7.3e-19 | 138 | 169 | 2 | 33 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT-- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCp 33 +Dgy WrKYGqK+vk+se+prsY++Ct+++C RrC21587_p1 138 NDGYGWRKYGQKQVKKSENPRSYFKCTFPNCV 169 8******************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.4E-15 | 133 | 168 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.54E-15 | 134 | 169 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.8E-7 | 137 | 170 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.5E-13 | 138 | 168 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 15.342 | 138 | 170 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MSSTSFTDLL ASSGVDCYEQ GEDFLGGFYP ETTGSGLPKF KTAQPPPLPI SQPPQNFAFS 60 SELLDSPLLL SSSHSLISPT TGAFPFPWQI QSQSQPPNAA SEETYGVQDL QKKQDPVPPP 120 CEFADRVPSY MVVSRNSNDG YGWRKYGQKQ VKKSENPRSY FKCTFPNCVS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY33 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Plays a partial role in heat stress tolerance (PubMed:19125253). Functions with WRKY26 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253, ECO:0000269|PubMed:21336597}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt stress (PubMed:18839316). Induced by heat stress (PubMed:19125253). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU912396 | 1e-93 | EU912396.1 Brassica napus WRKY25-1 transcription factor (WRKY25-1) mRNA, complete cds. | |||
GenBank | KM593146 | 1e-93 | KM593146.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY51) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018478533.1 | 5e-87 | PREDICTED: probable WRKY transcription factor 25 | ||||
Swissprot | O22921 | 2e-65 | WRK25_ARATH; Probable WRKY transcription factor 25 | ||||
TrEMBL | M4DYM7 | 4e-85 | M4DYM7_BRARP; Uncharacterized protein | ||||
STRING | Bra021623.1-P | 6e-86 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30250.1 | 2e-56 | WRKY DNA-binding protein 25 |
Publications ? help Back to Top | |||
---|---|---|---|
|