PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC2122_p4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 265aa MW: 30897.1 Da PI: 7.3012 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175 | 2.2e-54 | 10 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra+ sgyWkatg+dk+++s ++++ RrC2122_p4 10 LPPGFRFHPTDEELIVYYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHS-GSRN 106 79****************************.89***************99999*****************************************.99** PP NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128 vg+kk Lvfykgr pkg ktdW+mheyrl RrC2122_p4 107 VGVKKALVFYKGRPPKGIKTDWIMHEYRL 135 ***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.76E-66 | 6 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.935 | 10 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.7E-27 | 11 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 265 aa Download sequence Send to blast |
MEINSNSTTL PPGFRFHPTD EELIVYYLRN QTMSKPCPVS IIPEVDIYKF DPWQLPEKTE 60 FGENEWYFFS PRERKYPNGV RPNRAAVSGY WKATGTDKAI HSGSRNVGVK KALVFYKGRP 120 PKGIKTDWIM HEYRLQDSRK ASTKRNGSMR LDEWVLCRIY KKRGAGKLLD EKEGFMDEVQ 180 IDETLAERRN EEEIMMMTST KLPRTCSLAH LLEMDYMGPI SHILTPFDLH HPDLNGMNES 240 GWFGDLQVNQ DEISNHHRQA SMFQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-70 | 9 | 167 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-70 | 9 | 167 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-70 | 9 | 167 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-70 | 9 | 167 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-70 | 9 | 167 | 19 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-70 | 9 | 167 | 16 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-70 | 9 | 167 | 16 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF957836 | 0.0 | JF957836.1 Brassica napus NAC2 mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018445318.1 | 0.0 | PREDICTED: NAC transcription factor 29-like | ||||
Swissprot | O49255 | 1e-168 | NAC29_ARATH; NAC transcription factor 29 | ||||
TrEMBL | A0A078F6Q2 | 0.0 | A0A078F6Q2_BRANA; BnaA07g24270D protein | ||||
TrEMBL | A0A397YYT5 | 0.0 | A0A397YYT5_BRACM; Uncharacterized protein | ||||
STRING | Bra004385.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7707 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-171 | NAC-like, activated by AP3/PI |