PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC10672_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 159aa MW: 17429.8 Da PI: 9.1181 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 77.3 | 4.8e-24 | 5 | 61 | 4 | 60 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaae 60 +++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ RrC10672_p1 5 ATAAEQLCYIPCNFCNIVLAVSVPGSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRP 61 5689*******************************************9999887755 PP | |||||||
2 | YABBY | 102.7 | 7.4e-32 | 83 | 143 | 100 | 160 |
YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknW 160 s+ + + ++++ v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aakn RrC10672_p1 83 ISSRISARTISEQRVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNV 143 235556778888888*********************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 6.4E-59 | 7 | 143 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.4E-6 | 97 | 139 | IPR009071 | High mobility group box domain |
CDD | cd00084 | 3.65E-4 | 107 | 134 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MSNSATAAEQ LCYIPCNFCN IVLAVSVPGS SLFDIVTVRC GHCTNLWSVN MAAALQSLSR 60 PNFQATPYAT PEYGSSSRGH TKISSRISAR TISEQRVVNR PPEKRQRVPS AYNQFIKEEI 120 QRIKANNPDI SHREAFSTAA KNVCMIISAG ALKYNGTEC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353291 | 1e-151 | AK353291.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-24-G08. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018466116.1 | 1e-101 | PREDICTED: axial regulator YABBY 5 | ||||
Refseq | XP_018466117.1 | 1e-101 | PREDICTED: axial regulator YABBY 5 | ||||
Refseq | XP_018466118.1 | 1e-101 | PREDICTED: axial regulator YABBY 5 | ||||
Swissprot | Q8GW46 | 2e-92 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A3N6R399 | 3e-97 | A0A3N6R399_BRACR; Uncharacterized protein | ||||
STRING | Bo3g041840.1 | 2e-97 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5538 | 26 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 8e-95 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|