PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

30138.m004082

Common Name

RCOM_1472910

Organism

Ricinus communis

Taxonomic ID

3988

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus

Family

MYB

Protein Properties

Length: 332aa MW: 37127.4 Da PI: 6.51

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
30138.m004082	genome	JCVI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.4	1.5e-17	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl 30138.m004082 16 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 63 79****************************99**********97 PP
2	Myb_DNA-binding	49	1.4e-15	69	114	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E++ +v++ ++lG++ W++Ia++++ Rt++++k++w+++l 30138.m004082 69 RGNFTDHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 114 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.6E-23	7	66	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.836	11	67	IPR017930	Myb domain
SuperFamily	SSF46689	4.59E-30	13	110	IPR009057	Homeodomain-like
SMART	SM00717	2.4E-14	15	65	IPR001005	SANT/Myb domain
Pfam	PF00249	3.3E-16	16	63	IPR001005	SANT/Myb domain
CDD	cd00167	3.44E-11	18	63	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.4E-24	67	118	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.051	68	118	IPR017930	Myb domain
SMART	SM00717	6.8E-15	68	116	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-13	69	114	IPR001005	SANT/Myb domain
CDD	cd00167	2.22E-10	71	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0010468	Biological Process	regulation of gene expression
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 332 aa Download sequence Send to blast
KDMGRPPCCE KIGVKKGPWT PEEDIILVSY IQEHGPGNWR SVPTNTGLLR CSKSCRLRWT 60 NYLRPGIKRG NFTDHEEKMI VHLQALLGNR WAAIASYLPQ RTDNDIKNYW NTHLKKKLTE 120 LKDGQDLDRL SVSQPKGQWE RRLQTDIHLA KQALCEALSL DKPTTPLTHL KPSVATTGAN 180 GASNLIIRPY QAQESNTSTA YASSAENIAR LLENWMKNSP RQVLTAENSS SSTEGAHSTT 240 IPSSQGFNLL FSFNSSSNSD ASQSVDENAN LTPETSLFQD ESKSDMEDNH HNHHLQQVPL 300 SLLEKWLFDE GAVQGHDDLV NISLEETAIG LF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-25	16	118	4	105	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	4e-25	16	118	27	128	MYB TRANSFORMING PROTEIN
1mse_C	4e-25	16	118	4	105	C-Myb DNA-Binding Domain
1msf_C	4e-25	16	118	4	105	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269\|PubMed:19625633, ECO:0000269\|PubMed:20149112, ECO:0000269\|PubMed:21398568, ECO:0000269\|PubMed:23404903, ECO:0000269\|PubMed:25616734, ECO:0000269\|PubMed:25869652, ECO:0000269\|PubMed:25912720, ECO:0000269\|PubMed:26725725, ECO:0000269\|PubMed:27577115}.
UniProt	Transcription factor. {ECO:0000305}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00579	DAP	Transfer from AT5G62470	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	30138.m004082

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269\|PubMed:10226370, ECO:0000269\|PubMed:19625633, ECO:0000269\|PubMed:25912720}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002514763.2	0.0	myb-related protein 306
Swissprot	P81392	1e-119	MYB06_ANTMA; Myb-related protein 306
Swissprot	Q24JK1	1e-119	MYB96_ARATH; Transcription factor MYB96
TrEMBL	B9RLZ4	0.0	B9RLZ4_RICCO; R2r3-myb transcription factor, putative (Fragment)
STRING	XP_002514763.1	0.0	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1016	34	115

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62470.2	1e-118	myb domain protein 96

Link Out ? help Back to Top
Phytozome	30138.m004082

Publications ? help Back to Top
Geri C,Cecchini E,Giannakou ME,Covey SN,Milner JJ Altered patterns of gene expression in Arabidopsis elicited by cauliflower mosaic virus (CaMV) infection and by a CaMV gene VI transgene. Mol. Plant Microbe Interact., 1999. 12(5): p. 377-84 [PMID:10226370] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lee HG,Seo PJ The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis. Plant J., 2015. 82(6): p. 962-77 [PMID:25912720] Lee HG,Mas P,Seo PJ MYB96 shapes the circadian gating of ABA signaling in Arabidopsis. Sci Rep, 2016. 6: p. 17754 [PMID:26725725] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495] Lee HG,Choi YR,Seo PJ Increased STM expression is associated with drought tolerance in Arabidopsis. J. Plant Physiol., 2016. 201: p. 79-84 [PMID:27448723] Lee SB,Kim HU,Suh MC MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis. Plant Cell Physiol., 2016. 57(11): p. 2300-2311 [PMID:27577115] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Li P, et al. The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses. Physiol Plant, 2017. 159(4): p. 416-432 [PMID:27747895] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Lee HG,Kim H,Suh MC,Kim HU,Seo PJ The MYB96 Transcription Factor Regulates Triacylglycerol Accumulation by Activating DGAT1 and PDAT1 Expression in Arabidopsis Seeds. Plant Cell Physiol., 2018. 59(7): p. 1432-1442 [PMID:29660088] Lee HG,Seo PJ MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis. Nat Commun, 2019. 10(1): p. 1713 [PMID:30979883]