PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G62470.2
Common NameATMYB96, MYB96, MYBCOV1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 352aa    MW: 39187.5 Da    PI: 6.0544
Description myb domain protein 96
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G62470.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++ + g++R+ k+c++rw +yl
      AT5G62470.2 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.97.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
      AT5G62470.2  67 RGNFTEHEEKTIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.71965IPR017930Myb domain
SuperFamilySSF466892.02E-3011108IPR009057Homeodomain-like
SMARTSM007172.7E-151363IPR001005SANT/Myb domain
PfamPF002493.7E-171461IPR001005SANT/Myb domain
CDDcd001671.19E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.27566116IPR017930Myb domain
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.3E-1467112IPR001005SANT/Myb domain
CDDcd001678.10E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000027anatomylateral root tip
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRPPCCEKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKTIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
ESGEEDNDGV SSSNTSSQKN HQSTNKGQWE RRLQTDINMA KQALCEALSL DKPSSTLSSS  180
SSLPTPVITQ QNIRNFSSAL LDRCYDPSSS SSSTTTTTTS NTTNPYPSGV YASSAENIAR  240
LLQDFMKDTP KALTLSSSSP VSETGPLTAA VSEEGGEGFE QSFFSFNSMD ETQNLTQETS  300
FFHDQVIKPE ITMDQDHGLI SQGSLSLFEK WLFDEQSHEM VGMALAGQEG MF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26141164105C-Myb DNA-Binding Domain
1msf_C1e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.93030.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247455_at0.0
Expression AtlasAT5G62470-
AtGenExpressAT5G62470-
ATTED-IIAT5G62470-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves, flowers, guard cells and lateral root primordia. {ECO:0000269|PubMed:19625633}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a R2R3 type Myb transcription factor whose expression is strongly induced by abscisic acid. Mediates abscisic acid signaling during drought stress response.
UniProtTranscription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:20149112, ECO:0000269|PubMed:21398568, ECO:0000269|PubMed:23404903, ECO:0000269|PubMed:25616734, ECO:0000269|PubMed:25869652, ECO:0000269|PubMed:25912720, ECO:0000269|PubMed:26725725, ECO:0000269|PubMed:27577115}.
Function -- GeneRIF ? help Back to Top
  1. It was proposed that MYB96 is a molecular link that mediates abscisic acid-auxin cross talk in drought stress response and lateral root growth, providing an adaptive strategy under drought stress conditions.
    [PMID: 19625633]
  2. MYB96 is a molecular link that mediates abscisic acid-salicylic acid crosstalks.
    [PMID: 20149112]
  3. Activation of cuticular wax biosynthesis by drought and abscisic acid requires MYB96.
    [PMID: 21398568]
  4. MYB96 directly regulates LTP3 expression.
    [PMID: 23404903]
  5. Transgenic Camelina plants overexpressing Arabidopsis MYB96 enhanced tolerance to drought. Deposition of epicuticular wax crystals and total wax loads increased significantly on the surfaces of transgenic leaves.
    [PMID: 24880908]
  6. The Arabidopsis MYB96 transcription factor plays a role in seed dormancy.
    [PMID: 25616734]
  7. MYB96-ABI4 module regulates lipid mobilization specifically in the embryo to ensure proper seed germination under suboptimal conditions.
    [PMID: 25869652]
  8. MYB96 is induced by cold stress in an abscisic acid -independent manner and subsequently activates freezing tolerance.
    [PMID: 25912720]
  9. MYB96 integrates a multitude of environmental stress signals and acts as a master regulator in the determination of timing for seed germination.
    [PMID: 26313409]
  10. MYB96 regulates abscisic acid gated induction of TOC1.
    [PMID: 26725725]
  11. The data collectively indicate that MYB94 and MYB96 exert an additive effect on cuticular wax biosynthesis, which may represent an efficient adaptive mechanism of response to drought in plants.
    [PMID: 27577115]
  12. This study showed that ABA regulates the expression of MYB30-responsive genes during pathogen infection and this regulation is partly dependent on MIEL1.
    [PMID: 27615387]
  13. MYB30-INTERACTING E3 LIGASE 1 (MIEL1) E3 ubiquitin ligase controls the protein stability of the two MYB transcription factors, MYB96 and MYB30, and thereby wax biosynthesis in Arabidopsis. These observations indicate that the MIEL1-MYB96 module is important for balanced cuticular wax biosynthesis in developing inflorescence stems.
    [PMID: 28838126]
  14. MYB96 is a crucial regulator of triacylglycerol accumulation during seed maturation, which transcriptionally activates DGAT1 and PDAT1. The MYB96 gene is highly expressed in developing seeds and positively regulates triacylglycerol biosynthesis in seeds.
    [PMID: 29660088]
  15. MYB96 interacts with the histone modifier HDA15 to suppress negative regulators of early abscisic acid signaling
    [PMID: 30979883]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G62470.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269|PubMed:10226370, ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:25912720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G62470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289770.0AK228977.1 Arabidopsis thaliana mRNA for MYB96 transcription factor-like protein, complete cds, clone: RAFL16-28-G04.
GenBankBT0248880.0BT024888.1 Arabidopsis thaliana At5g62470 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201053.20.0myb domain protein 96
SwissprotQ24JK10.0MYB96_ARATH; Transcription factor MYB96
TrEMBLA0A178UF540.0A0A178UF54_ARATH; MYBCOV1
STRINGAT5G62470.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Geri C,Cecchini E,Giannakou ME,Covey SN,Milner JJ
    Altered patterns of gene expression in Arabidopsis elicited by cauliflower mosaic virus (CaMV) infection and by a CaMV gene VI transgene.
    Mol. Plant Microbe Interact., 1999. 12(5): p. 377-84
    [PMID:10226370]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  5. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  6. Devoto A, et al.
    Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions.
    Plant Mol. Biol., 2005. 58(4): p. 497-513
    [PMID:16021335]
  7. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Seo PJ, et al.
    The MYB96 transcription factor mediates abscisic acid signaling during drought stress response in Arabidopsis.
    Plant Physiol., 2009. 151(1): p. 275-89
    [PMID:19625633]
  10. Seo PJ,Park CM
    Auxin homeostasis during lateral root development under drought condition.
    Plant Signal Behav, 2009. 4(10): p. 1002-4
    [PMID:19826230]
  11. Seo PJ,Park CM
    MYB96-mediated abscisic acid signals induce pathogen resistance response by promoting salicylic acid biosynthesis in Arabidopsis.
    New Phytol., 2010. 186(2): p. 471-83
    [PMID:20149112]
  12. Seo PJ, et al.
    The MYB96 transcription factor regulates cuticular wax biosynthesis under drought conditions in Arabidopsis.
    Plant Cell, 2011. 23(3): p. 1138-52
    [PMID:21398568]
  13. Seo PJ,Park CM
    Cuticular wax biosynthesis as a way of inducing drought resistance.
    Plant Signal Behav, 2011. 6(7): p. 1043-5
    [PMID:21617381]
  14. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  15. Guo L,Yang H,Zhang X,Yang S
    Lipid transfer protein 3 as a target of MYB96 mediates freezing and drought stress in Arabidopsis.
    J. Exp. Bot., 2013. 64(6): p. 1755-67
    [PMID:23404903]
  16. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  17. Li-Beisson Y, et al.
    Acyl-lipid metabolism.
    Arabidopsis Book, 2013. 11: p. e0161
    [PMID:23505340]
  18. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  19. Lee SB,Kim H,Kim RJ,Suh MC
    Overexpression of Arabidopsis MYB96 confers drought resistance in Camelina sativa via cuticular wax accumulation.
    Plant Cell Rep., 2014. 33(9): p. 1535-46
    [PMID:24880908]
  20. Lee HG,Lee K,Seo PJ
    The Arabidopsis MYB96 transcription factor plays a role in seed dormancy.
    Plant Mol. Biol., 2015. 87(4-5): p. 371-81
    [PMID:25616734]
  21. Lee K,Lee HG,Yoon S,Kim HU,Seo PJ
    The Arabidopsis MYB96 Transcription Factor Is a Positive Regulator of ABSCISIC ACID-INSENSITIVE4 in the Control of Seed Germination.
    Plant Physiol., 2015. 168(2): p. 677-89
    [PMID:25869652]
  22. Lee HG,Seo PJ
    The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis.
    Plant J., 2015. 82(6): p. 962-77
    [PMID:25912720]
  23. Lee K,Seo PJ
    Coordination of seed dormancy and germination processes by MYB96.
    Plant Signal Behav, 2015. 10(9): p. e1056423
    [PMID:26313409]
  24. Lee HG,Mas P,Seo PJ
    MYB96 shapes the circadian gating of ABA signaling in Arabidopsis.
    Sci Rep, 2016. 6: p. 17754
    [PMID:26725725]
  25. Cui F, et al.
    Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
    Mol Plant, 2016. 9(6): p. 926-38
    [PMID:27060495]
  26. Lee HG,Choi YR,Seo PJ
    Increased STM expression is associated with drought tolerance in Arabidopsis.
    J. Plant Physiol., 2016. 201: p. 79-84
    [PMID:27448723]
  27. Lee SB,Kim HU,Suh MC
    MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.
    Plant Cell Physiol., 2016. 57(11): p. 2300-2311
    [PMID:27577115]
  28. Lee HG,Seo PJ
    The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
    Nat Commun, 2016. 7: p. 12525
    [PMID:27615387]
  29. Li P, et al.
    The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses.
    Physiol Plant, 2017. 159(4): p. 416-432
    [PMID:27747895]
  30. Lee HG,Kim J,Suh MC,Seo PJ
    The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
    Plant Cell Physiol., 2017. 58(7): p. 1249-1259
    [PMID:28838126]
  31. Lee HG,Kim H,Suh MC,Kim HU,Seo PJ
    The MYB96 Transcription Factor Regulates Triacylglycerol Accumulation by Activating DGAT1 and PDAT1 Expression in Arabidopsis Seeds.
    Plant Cell Physiol., 2018. 59(7): p. 1432-1442
    [PMID:29660088]
  32. Lee HG,Seo PJ
    MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis.
    Nat Commun, 2019. 10(1): p. 1713
    [PMID:30979883]