PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 30138.m003939 | ||||||||
Common Name | LOC8265057, RCOM_1468080 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 28256.1 Da PI: 9.8742 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.6 | 5.1e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+ 30138.m003939 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSTKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 105 | 9.6e-35 | 78 | 174 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++ +++++++ s++ e+akLk+++e Lqr+qRh++Ge+L++L+lk+Lq+Leqq++++lk++Rs+Kn+l++e+i+elqkk k+lqe+n++L kk++ 30138.m003939 78 RQLLATDTETNGSWTLEHAKLKARVEVLQRNQRHFMGEELDTLTLKDLQNLEQQIDSALKHVRSRKNQLMYESISELQKKDKALQEQNNQLAKKVK 173 5555667788899*********************************************************************************98 PP K-box 100 e 100 e 30138.m003939 174 E 174 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.422 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-34 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.64E-43 | 2 | 79 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-28 | 86 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.79 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0032440 | Molecular Function | 2-alkenal reductase [NAD(P)] activity | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIVFST KGKLFEYSTD 60 SCMERILERY ERYSYAERQL LATDTETNGS WTLEHAKLKA RVEVLQRNQR HFMGEELDTL 120 TLKDLQNLEQ QIDSALKHVR SRKNQLMYES ISELQKKDKA LQEQNNQLAK KVKEKEKAKA 180 QQTQWEQQNQ GVDSSPVLLP QPIQSMNIRS THPARGSTGE DETTPIHNRA NALLPAWMLT 240 HFNE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 30138.m003939 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002514623.1 | 0.0 | truncated transcription factor CAULIFLOWER A | ||||
Swissprot | Q6E6S7 | 1e-123 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | B9RLK4 | 0.0 | B9RLK4_RICCO; Mads box protein, putative | ||||
STRING | XP_002514623.1 | 0.0 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 5e-99 | AGAMOUS-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 30138.m003939 |
Entrez Gene | 8265057 |
Publications ? help Back to Top | |||
---|---|---|---|
|