PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29739.m003586 | ||||||||
Common Name | LOC8258551, RCOM_0706470 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18034.9 Da PI: 6.358 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.3 | 1.2e-31 | 98 | 156 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+ +gCpvkk+ver+++d ++v++tYeg Hnh+ 29739.m003586 98 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVEGCPVKKRVERDKDDLRFVITTYEGIHNHP 156 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.0E-33 | 84 | 157 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.71E-28 | 91 | 156 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.699 | 93 | 158 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.5E-36 | 98 | 157 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.8E-25 | 99 | 156 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MSHYSAGSQE SDYGDPTNFE LSEFLMFDEW IEDANDQSSL LSGSIQNPVY RAHVVGESGG 60 AISPYGEHSN GEGREGSREK KGVKERVAFK TKSEIEILDD GFKWRKYGKK MVKNSPNPRN 120 YYRCSVEGCP VKKRVERDKD DLRFVITTYE GIHNHPSSC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 3e-25 | 86 | 155 | 2 | 71 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 29739.m003586 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT827597 | 2e-64 | KT827597.1 Manihot esculenta WRKY transcription factor 22 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002516104.1 | 1e-116 | probable WRKY transcription factor 50 isoform X2 | ||||
Swissprot | Q8VWQ5 | 2e-43 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | B9RQT5 | 1e-115 | B9RQT5_RICCO; WRKY transcription factor, putative | ||||
STRING | XP_002516104.1 | 1e-116 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 8e-44 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29739.m003586 |
Entrez Gene | 8258551 |
Publications ? help Back to Top | |||
---|---|---|---|
|