PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.008G233800.1 | ||||||||
Common Name | PHAVU_008G233800g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 204aa MW: 23024.3 Da PI: 8.9483 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.1 | 2.6e-15 | 1 | 44 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +++Ed++l+d+++ +G g+W++I++ g++R++k+c++rw++yl Phvul.008G233800.1 1 SKQEDQKLIDYIRVHGEGCWRSIPKAAGLHRCGKSCRLRWLNYL 44 689***************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.3 | 1.2e-15 | 51 | 94 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g + ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++ Phvul.008G233800.1 51 GIFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 94 66779****************.*********.***********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.604 | 1 | 44 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-20 | 1 | 51 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.00E-10 | 1 | 44 | No hit | No description |
Pfam | PF00249 | 1.5E-13 | 1 | 44 | IPR001005 | SANT/Myb domain |
SMART | SM00717 | 4.0E-8 | 1 | 46 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.98E-26 | 1 | 91 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.309 | 45 | 99 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-14 | 49 | 97 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.8E-25 | 52 | 100 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.7E-14 | 53 | 94 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.20E-11 | 55 | 95 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
SKQEDQKLID YIRVHGEGCW RSIPKAAGLH RCGKSCRLRW LNYLRPDIKR GIFAEDEEDL 60 IIKLHALLGN RWSLIAGRLP GRTDNEVKNY WNSHIRRKLI KMGIDPNNHK PHQSVSFPHS 120 SSAEGASNTE SMNKDHRIPI FPVAATHHRI SFREEESAII SSPTLNLDLT IALPSSMIGA 180 LEEKAIQNSK STKTLDMEID LNC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 1 | 99 | 11 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.008G233800.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT090465 | 1e-151 | BT090465.1 Soybean clone JCVI-FLGm-4F17 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007141884.1 | 1e-150 | hypothetical protein PHAVU_008G233800g, partial | ||||
Swissprot | Q9SZP1 | 8e-67 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | V7BAJ2 | 1e-148 | V7BAJ2_PHAVU; Uncharacterized protein (Fragment) | ||||
STRING | XP_007141884.1 | 1e-149 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF264 | 34 | 221 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 3e-69 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.008G233800.1 |
Entrez Gene | 18623802 |