PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Phvul.006G202200.1

Common Name

PHAVU_006G202200g

Organism

Phaseolus vulgaris

Taxonomic ID

3885

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus

Family

MIKC_MADS

Protein Properties

Length: 206aa MW: 23807.4 Da PI: 10.2117

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Phvul.006G202200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	74.7	7.5e-24	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i n + rqvtfskR+ g+lKKA ELS LCdae+a+++fs+ gkl++y+s Phvul.006G202200.1 9 KKIVNVTARQVTFSKRKSGLLKKARELSLLCDAEIALMVFSPGGKLFDYAS 59 679999*******************************************86 PP
2	K-box	48.2	4.6e-17	87	170	15	98
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 e+ + +a Lkke+e re R+l Ge+L+ Ls+keLq+Le +Le+sl+ + + K + +++ i+ l +k+++l e+n+ L++++ Phvul.006G202200.1 87 EQIRSSHAYLKKELEDRSREMRQLNGEELQGLSFKELQKLEGRLESSLNCVYKAKVQNFIRDINILTQKQNKLMEDNRLLKQRI 170 667778899************************************************************************988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.8E-35	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	27.88	1	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-25	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.62E-28	3	76	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.13E-34	3	69	No hit	No description
Pfam	PF00319	1.9E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-25	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	11.597	86	176	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.5E-15	87	170	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 206 aa Download sequence Send to blast
MVRKKIPIKK IVNVTARQVT FSKRKSGLLK KARELSLLCD AEIALMVFSP GGKLFDYASS 60 SMQKITERHI LRSEFNQDKL DQLPPTEQIR SSHAYLKKEL EDRSREMRQL NGEELQGLSF 120 KELQKLEGRL ESSLNCVYKA KVQNFIRDIN ILTQKQNKLM EDNRLLKQRI SSRNEICSVQ 180 RHEHEQEQSF DTSLTLGLPF PSDSK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	7e-20	1	77	1	74	MEF2C
5f28_B	7e-20	1	77	1	74	MEF2C
5f28_C	7e-20	1	77	1	74	MEF2C
5f28_D	7e-20	1	77	1	74	MEF2C
6byy_A	9e-20	1	88	1	93	MEF2 CHIMERA
6byy_B	9e-20	1	88	1	93	MEF2 CHIMERA
6byy_C	9e-20	1	88	1	93	MEF2 CHIMERA
6byy_D	9e-20	1	88	1	93	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Phvul.006G202200.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015038	3e-70	AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007148366.1	1e-149	hypothetical protein PHAVU_006G202200g
Swissprot	Q9FVC1	2e-48	SVP_ARATH; MADS-box protein SVP
TrEMBL	V7BTI9	1e-147	V7BTI9_PHAVU; Uncharacterized protein
STRING	XP_007148366.1	1e-148	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF26660	2	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22540.1	8e-51	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Phvul.006G202200.1
Entrez Gene	18629395

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]