PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.003G217700.1 | ||||||||
Common Name | PHAVU_003G217700g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 216aa MW: 23982.4 Da PI: 7.5558 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 233.1 | 6.5e-72 | 11 | 179 | 2 | 170 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesa 92 d+ seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++ +++ hl++s+ + ++ l+ + +++++ Phvul.003G217700.1 11 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLVPSPTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQTNL 101 577899***********************************************************99886666655555555555555555 PP YABBY 93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 s s++ ++ + +e+pr+p ++rPPekrqrvPsaynrfik+eiqrik+ nPdi+hreafsaaaknWahfP+ihfgl Phvul.003G217700.1 102 SVSNEFSMPARTAADELPRPPIINRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGL 179 5555555557889999***999******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.2E-69 | 15 | 179 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.96E-7 | 123 | 172 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 4.5E-4 | 128 | 171 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MSSSSTTISL DHLPPSEQLC YVHCNICDTV LAVSVPCTSL FKTVTVRCGH CTNLLPVNMR 60 GLLVPSPTQF HLGHSFFSPS HNLLEEIPNP SPNFLMNQTN LSVSNEFSMP ARTAADELPR 120 PPIINRPPEK RQRVPSAYNR FIKDEIQRIK SVNPDITHRE AFSAAAKNWA HFPHIHFGLM 180 PDQTVKKTNV CQQEGEEVLM KDGFYASANV GVSPY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.003G217700.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ617272 | 1e-180 | FJ617272.1 Lotus japonicus YABBY1 protein (YABBY1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007155627.1 | 1e-160 | hypothetical protein PHAVU_003G217700g | ||||
Swissprot | O22152 | 8e-82 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | V7CFE1 | 1e-159 | V7CFE1_PHAVU; Uncharacterized protein | ||||
STRING | XP_007155627.1 | 1e-160 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2040 | 34 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 3e-84 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.003G217700.1 |
Entrez Gene | 18635657 |